UniProt UniProt http://www.uniprot.org Bin2, a functionally nonredundant member of the BAR adaptor gene family. Bin2, a functionally nonredundant member of the BAR adaptor gene family. Genomics (0888-7543) 2000 imex curation Ge K., Prendergast GC. george.c.prendergast@dupontpharma.com 16-Dec-2008: Contacted by JYOTI. davet Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ge K., Prendergast GC. george.c.prendergast@dupontpharma.com Accepted 2008-Not a month!-3 by DAVET. 16-Dec-2008: Contacted by JYOTI. Genomics (0888-7543) 2000 davet Only protein-protein interactions imex curation Bin2, a functionally nonredundant member of the BAR adaptor gene family. Bin2, a functionally nonredundant member of the BAR adaptor gene family. Genomics (0888-7543) 2000 imex curation Ge K., Prendergast GC. george.c.prendergast@dupontpharma.com 16-Dec-2008: Contacted by JYOTI. davet Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ge K., Prendergast GC. COS cells, not further specified, have been transfected. Tentatively chosen COS1. george.c.prendergast@dupontpharma.com Accepted 2008-Not a month!-3 by DAVET. 16-Dec-2008: Contacted by JYOTI. Genomics (0888-7543) 2000 davet Only protein-protein interactions imex curation bin1_human Myc box-dependent-interacting protein 1 Bridging integrator 1 Amphiphysin-like protein Box-dependent myc-interacting protein 1 BIN1 AMPHL Amphiphysin II protein protein human Homo sapiens Human MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP 0FF1956F0C7E3B50 bin2_human Bridging integrator 2 BIN2 BRAP1 Breast cancer-associated protein 1 protein protein human Homo sapiens Human MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEKQHSNKVFVVKGLSSSSRRSLVISPPVRTATVSSPLTSPTSPSTLSLKSESESVSATEDLAPDAAQGEDNSEIKELLEEEEIEKEGSEASSSEEDEPLPACNGPAQAQPSPTTERAKSQEEVLPSSTTPSPGGALSPSGQPSSSATEVVLRTRTASEGSEQPKKRASIQRTSAPPSRPPPPRATASPRPSSGNIPSSPTASGGGSPTSPRASLGTGTASPRTSLEVSPNPEPPEKPVRTPEAKENENIHNQNPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISANSSEGQDQLQVSMVPENNNLTAPEPQEEVSTSENPQL B1D1FB89A97E9E43 bin1-bin2 1 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 4A and C bin1-bin2-1 2 4 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role bait bait physical association physical association 4D