IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Localization of AtROP4 and AtROP6 and interaction with the guanine nucleotide dissociation inhibitor AtRhoGDI1 from Arabidopsis. Localization of AtROP4 and AtROP6 and interaction with the guanine nucleotide dissociation inhibitor AtRhoGDI1 from Arabidopsis. Plant Mol. Biol. (0167-4412) 2000 Bischoff F., Vahlkamp L., Molendijk A., Palme K. 14-May-2008: Contacted by JYOTI. orchard in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Bischoff F., Vahlkamp L., Molendijk A., Palme K. Accepted 2008-MAY-28 by ORCHARD. 14-May-2008: Contacted by JYOTI. Plant Mol. Biol. (0167-4412) 2000 orchard Localization of AtROP4 and AtROP6 and interaction with the guanine nucleotide dissociation inhibitor AtRhoGDI1 from Arabidopsis. Localization of AtROP4 and AtROP6 and interaction with the guanine nucleotide dissociation inhibitor AtRhoGDI1 from Arabidopsis. Plant Mol. Biol. (0167-4412) 2000 Bischoff F., Vahlkamp L., Molendijk A., Palme K. 14-May-2008: Contacted by JYOTI. orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bischoff F., Vahlkamp L., Molendijk A., Palme K. Accepted 2008-MAY-28 by ORCHARD. 14-May-2008: Contacted by JYOTI. Plant Mol. Biol. (0167-4412) 2000 orchard gdir_arath Rho GDP-dissociation inhibitor 1 GDI1 F17A17.22 At3g07880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLVSGARDMGFDDNNNNKNNKDGDDENSSSRTRADDDALSRQMSESSLCATEEEEDDDSKLQLGPQYTIKEHLEKDKDDESLRKWKEQLLGSVDVTNIGETLDPEVRIDSLAIISPGRPDIVLLVPENGNPKGMWFTLKEGSKYNLKFTFHVNNNIVSGLRYTNTVWKTGVKVDRAKEMLGTFSPQLEPYNHVMPEETTPSGMFARGSYSARTKFLDDDNKCYLEINYSFDIRKEWPAL DD1A504F8EC1459F rac3_arath Rac-like GTP-binding protein ARAC3 ARAC3 RAC1 ROP6 M4E13.80 At4g35020 GTPase protein ROP6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKLDLRDDKQFFAEHPGAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVLQPPKNKKKKKRKSQKGCSIL DIP protein Q38912 original sequence version: 66 154A01D1AAE3A766 rac5_arath Rac-like GTP-binding protein ARAC5 ARAC5 ATGP3 ROP4 T4O12.8 At1g75840 GTPase protein ROP4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNKNRCVFL DIP protein Q38937 original sequence version: 77 631317F3DA441A35 arac5-gdi1 2 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait Q38937:p.Thr20Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T N Wed May 02 20:10:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr20asn' Tue Jun 30 19:09:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr20Asn' physical association physical association Figure 7 We observed specific interaction of AtRhoGDI1 with wild-type AtROP4 and AtROP6, but not with control AtRAB11c arac3-gdi1 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait Q38912:p.Thr20Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T N Wed May 02 17:35:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr20asn' Tue Jun 30 18:52:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr20Asn' physical association physical association Figure 7 We observed specific interaction of AtRhoGDI1 with wild-type AtROP4 and AtROP6, but not with control AtRAB11c gdi1-arac5 1 5 unspecified role unspecified role prey prey n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tobac-by_2 Tobacco cell line by_2 Tobacco cell line An undifferentiated cell line derived from tobacco callus tissue. 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 8 On a western blot, a monoclonal anti-GFP antibody revealed a single 50 kDa protein corresponding in size to GFPAtROP4 if beads carrying GST-AtRhoGDI1 were applied to the cell extracts (Figure 8, lane 3). GST alone did not retain GFP-AtROP4 (lane 4).