IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The protein kinase CK2 is involved in regulation of circadian rhythms in Arabidopsis. The protein kinase CK2 is involved in regulation of circadian rhythms in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 imex curation Sugano S., Andronis C., Ong MS., Green RM., Tobin EM. etobin@ucla.edu 16-April-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Sugano S., Andronis C., Ong MS., Green RM., Tobin EM. etobin@ucla.edu Accepted 2008-APR-11 by ORCHARD. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 orchard Only protein-protein interactions imex curation The protein kinase CK2 is involved in regulation of circadian rhythms in Arabidopsis. The protein kinase CK2 is involved in regulation of circadian rhythms in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 imex curation Sugano S., Andronis C., Ong MS., Green RM., Tobin EM. etobin@ucla.edu 16-April-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Sugano S., Andronis C., Ong MS., Green RM., Tobin EM. etobin@ucla.edu Accepted 2008-APR-11 by ORCHARD. 16-April-2008: Contacted by JYOTI. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 orchard Only protein-protein interactions imex curation csk21_arath Casein kinase II subunit alpha-1 CKA1 Casein kinase alpha 1 K8K14.10 At5g67380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIDTLFFLFFLFFDSPLRRLLLLCAVLALRAPTAHSPILRSSIVTPTARAVSEVSGCTTIDPDFLVEISDSNQTRAMSKARVYTEVNVIRPKDYWDYESLIVQWGEQDDYEVVRKVGRGKYSEVFEGINVNSKEKCIIKILKPVKKKKIRREIKILQNLCGGPNIVKLLDVVRDQHSKTPSLIFEYVNSTDFKVLYPTLTDYDIRYYIYELLKALDFCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNQDQLVKIAKVLGTDELNAYLNKYQLELDPQLEALVGRHSRKPWSKFINADNQHLVSPEAIDFLDKLLRYDHQDRLTAKEAMAHAYFAQVRAAETSRMRSQ 35F553B9CDA53D33 csk2b_arath Casein kinase II subunit beta-1 CKB1 K14A3.3 At5g47080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYRDRGTVNSRPEVVDRKRINDALERPSPSTSRQVNGKGKGTVTAATTTANLIGKQQSNNINHRDSRSASLSKNNTVSDDESDTDSEESDVSGSDGEDTSWISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSLVPYYEYALDLILDVESSQGEMFTEEQNELIESAAEMLYGLIHARYILTSKGLAAMLDKYKNYDFGRCPRVYCCGQPCLPVGQSDLPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPAKATQNYVQRVFGFKLHKP 43C811727B0985EE csk2d_arath Casein kinase II subunit beta-3 CKB3 F27H5_40 At3g60250 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYKERSGGGGGGSSRSEILGGAIDRKRINDALNKKLEKSSTSTTTSRVFSSKDKDPFSFTSTKTQLPDVESETDSEGSDVSGSEGDDTSWISWFCNLRGNDFFCEVDEDYIQDDFNLCGLSGQVPYYDYALDLILDVDASNSEMFTDEQHEMVESAAEMLYGLIHVRYILTTKGMAAMTEKYKNCDFGRCPRVFCCGQSCLPVGQSDIPRSSTVKIYCPKCEDISYPRSKFQGNIDGAYFGTTFPHLFLMTYGNLKPQKPTQSYVPKIFGFKVHKP 611FFC1222B2CC55 cca1_arath Protein CCA1 CCA1 At2g46830 Protein CIRCADIAN CLOCK ASSOCIATED 1 MYB-related transcription factor CCA1 F19D11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress METNSSGEDLVIKTRKPYTITKQRERWTEEEHNRFIEALRLYGRAWQKIEEHVATKTAVQIRSHAQKFFSKVEKEAEAKGVAMGQALDIAIPPPRPKRKPNNPYPRKTGSGTILMSKTGVNDGKESLGSEKVSHPEMANEDRQQSKPEEKTLQEDNCSDCFTHQYLSAASSMNKSCIETSNASTFREFLPSREEGSQNNRVRKESNSDLNAKSLENGNEQGPQTYPMHIPVLVPLGSSITSSLSHPPSEPDSHPHTVAGDYQSFPNHIMSTLLQTPALYTAATFASSFWPPDSSGGSPVPGNSPPNLAAMAAATVAAASAWWAANGLLPLCAPLSSGGFTSHPPSTFGPSCDVEYTKASTLQHGSVQSREQEHSEASKARSSLDSEDVENKSKPVCHEQPSATPESDAKGSDGAGDRKQVDRSSCGSNTPSSSDDVEADASERQEDGTNGEVKETNEDTNKPQTSESNARRSRISSNITDPWKSVSDEGRIAFQALFSREVLPQSFTYREEHREEEQQQQEQRYPMALDLNFTAQLTPVDDQEEKRNTGFLGIGLDASKLMSRGRTGFKPYKRCSMEAKESRILNNNPIIHVEQKDPKRMRLETQAST 083C963EE6DD53A6 lhy_arath Protein LHY At1g01060 LHY Protein LATE ELONGATED HYPOCOTYL MYB-related transcription factor LHY T25K16.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRAWQRIEEHIGTKTAVQIRSHAQKFFTKLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPYPRKPGNNGTSSSQVSSAKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCSGVSTVNKYPLPTKQVSGDIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHFHADIVNGNIAKCPQNHPSGMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPACHSQDDYRSFLQISSTFSNLIMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSSPPSITAIAAATVAAATAWWASHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQPFEKQNTALQDQNLASKSPASSSDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTAQKKNLVDRSSCGSNTPSGSDAETDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDNNSNNNATTDSWKEVSEEGRIAFQALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNFKSQDSCAADQEGVVMIGVGTCKSLKTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCKRLRLEGEAST DC327F40AB75AAF5 cca1-cbk3-3 1 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 3A Although the authors state that "Fig. 3A shows that, like CCA1, LHY could bind to CKB1 and CKB3 efficiently and specifically in vitro".This is not the case only CCA1 interacting with CBK3 appears to be displayed in Fig 3A. at1g01060-cbk3-4 1 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 3A Although the authors state that "Fig. 3A shows that, like CCA1, LHY could bind to CKB1 and CKB3 efficiently and specifically in vitro".This is not the case only LHY (At1g01060) interacting with CBK3 appears to be displayed in Fig 3A. at1g01060-cka1-3 2 7 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 stimulator stimulator ancillary ancillary region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 3 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Figure 3B and Figure 3C Phosphorylation of LHY by CK2 in vitro The authors noted that "CK2 b-subunits enhance phosphorylation of LHY by CKA1.". O81275 stimulated phosphorylation of P92973 Phosphorylation of P92973 Details of production of recombinant proteins were obtained from references provided in text. at1g01060-cka1-4 2 3 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) 7 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 stimulator stimulator ancillary ancillary ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Figure 3B and Figure 3C Phosphorylation of LHY by CK2 The authors noted that "CK2 b-subunits enhance phosphorylation of LHY by CKA1.". P40228 stimulated phosphorylation of P92973 Phosphorylation of P92973 Details of production of recombinant proteins were obtained from references provided in text.