IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The RING finger motif of photomorphogenic repressor COP1 specifically interacts with the RING-H2 motif of a novel Arabidopsis protein. The RING finger motif of photomorphogenic repressor COP1 specifically interacts with the RING-H2 motif of a novel Arabidopsis protein. J. Biol. Chem. (0021-9258) 1999 imex curation Torii KU., Stoop-Myer CD., Okamoto H., Coleman JE., Matsui M., Deng XW. xingwang.deng@yale.edu 16-Dec-2008: Contacted by JYOTI. Arabidopsis light grown seedling cDNA library jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Torii KU., Stoop-Myer CD., Okamoto H., Coleman JE., Matsui M., Deng XW. xingwang.deng@yale.edu Accepted 2008-DEC-19 by JYOTI. 16-Dec-2008: Contacted by JYOTI. Arabidopsis light grown seedling cDNA library J. Biol. Chem. (0021-9258) 1999 jyoti Only protein-protein interactions imex curation The RING finger motif of photomorphogenic repressor COP1 specifically interacts with the RING-H2 motif of a novel Arabidopsis protein. The RING finger motif of photomorphogenic repressor COP1 specifically interacts with the RING-H2 motif of a novel Arabidopsis protein. J. Biol. Chem. (0021-9258) 1999 imex curation Torii KU., Stoop-Myer CD., Okamoto H., Coleman JE., Matsui M., Deng XW. xingwang.deng@yale.edu 16-Dec-2008: Contacted by JYOTI. Arabidopsis light grown seedling cDNA library jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Torii KU., Stoop-Myer CD., Okamoto H., Coleman JE., Matsui M., Deng XW. xingwang.deng@yale.edu Accepted 2008-DEC-19 by JYOTI. 16-Dec-2008: Contacted by JYOTI. Arabidopsis light grown seedling cDNA library J. Biol. Chem. (0021-9258) 1999 jyoti Only protein-protein interactions imex curation The RING finger motif of photomorphogenic repressor COP1 specifically interacts with the RING-H2 motif of a novel Arabidopsis protein. The RING finger motif of photomorphogenic repressor COP1 specifically interacts with the RING-H2 motif of a novel Arabidopsis protein. J. Biol. Chem. (0021-9258) 1999 imex curation Torii KU., Stoop-Myer CD., Okamoto H., Coleman JE., Matsui M., Deng XW. xingwang.deng@yale.edu 16-Dec-2008: Contacted by JYOTI. Arabidopsis light grown seedling cDNA library jyoti Only protein-protein interactions in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Torii KU., Stoop-Myer CD., Okamoto H., Coleman JE., Matsui M., Deng XW. Protein detection was carried out using silver staining. xingwang.deng@yale.edu Accepted 2008-DEC-19 by JYOTI. 16-Dec-2008: Contacted by JYOTI. Arabidopsis light grown seedling cDNA library J. Biol. Chem. (0021-9258) 1999 jyoti Only protein-protein interactions imex curation cop1_arath E3 ubiquitin-protein ligase COP1 COP1 Constitutive photomorphogenesis protein 1 RING-type E3 ubiquitin transferase COP1 T21L14.11 At2g32950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSEIGAPDLDKDLLCPICMQIIKDAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTASPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFNSNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARKKRIHAQFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA DIP protein P43254 original sequence version: 138 DIP protein P43254 original sequence version: 113 DIP protein P43254 original sequence version: 114 E6D9A1B702EAE8F0 cip8_arath E3 ubiquitin-protein ligase CIP8 CIP8 COP1-interacting protein 8 RING-type E3 ubiquitin transferase CIP8 MXK3.15 At5g64920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSDAPSSSPDATASHWCYHCNKRVVVETLDDFVVCCECNKGFVESIQPTPAAYSSPAPPQPLSPDLNVEDSSIGSHFLQMLRLLAHAPSQRSPPRHLDVLSYEDDFFRLELNSRNEIDDDEDEDEDDGDEEEEDEEENLTVNDEEDEEDDLRRRNRFPLTTTQSRTGRNRILDWAEILMGIEDNSIEFRMESDRYAGNPADYIDDAAGYEALLQNLAEGDGGGGGGRRGAPPAAKSAIEALETFEVSSSEGEMVMVCAVCKDGMVMGETGKKLPCGHCYHGDCIVPWLGTRNSCPVCRFQLETDDAEYEEERKKRTSTVSDSAAASSSSSTSRY 59EADBA18782E0B8 cop1-cip8-1 2 5 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Three of the four cDNAs displayed specific interaction to the LexA-N282 protein (data not shown). Sequencing analysis of the three classes of cDNAs revealed that one of them codes for a partial 92-amino acid fragment largely consisting of a RING-H2 motif, a variant type of the RING finger (Fig. 1A). This clone was designated CIP8. Because it exhibited strong and specific interaction to the COP1 RING finger, it was further characterized. cop1-cip8-2 1 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P43254:p.[Cys67Ala;His69Ala;Cys72Ala;Cys75Ala] cys67ala-his69ala-cys72ala-cys75ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain C A Fri Jul 22 11:04:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys75ala,cys72ala,his69ala,cys67ala' Wed May 02 18:29:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys67ala,his69ala,cys72ala,cys75ala' Tue Jun 30 16:26:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys67Ala;His69Ala;Cys72Ala;Cys75Ala]' physical association physical association The RING finger domain of COP1 interacts with CIP8 in the yeast two-hybrid system Figure 1 Figure 4A The authors incorrectly state that the data from the mutated form of COP1 is presented in Fig 3A whereas it is presented in Fig 4A. cop1-cip8-3 1 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9SPL2:p.[Cys275Ala;His277Ala;His280Ala;Cys283Ala] cys275ala-his277ala-his280ala-cys283ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain H A Fri Jul 22 10:58:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys283ala,his277ala,cys275ala,his280ala' Wed May 02 16:03:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys275ala,his277ala,his280ala,cys283ala' Tue Jun 30 16:45:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys275Ala;His277Ala;His280Ala;Cys283Ala]' 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association The RING finger domain of COP1 interacts with CIP8 in the yeast two-hybrid system Figure 1 Figure 4A The authors incorrectly state that the data from the mutated form of CIP8 is presented in Fig 3A whereas it is presented in Fig 4A. cop1-cip8-4 3 5 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association The RING finger of COP1 interacts directly with the RING H2 finger of CIP8 in vitro. Figure 2