IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Cell (0092-8674) 2007 imex curation Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov 01-April-2008: Contacted by JYOTI. Only protein-protein interactions 13 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Accepted 2008-FEB-30 by CDEROW. 01-April-2008: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Cell (0092-8674) 2007 imex curation Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov 01-April-2008: Contacted by JYOTI. Only protein-protein interactions 13 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Accepted 2008-FEB-30 by CDEROW. 01-April-2008: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Cell (0092-8674) 2007 imex curation Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov 01-April-2008: Contacted by JYOTI. Only protein-protein interactions 13 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Accepted 2008-FEB-30 by CDEROW. 01-April-2008: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Cell (0092-8674) 2007 imex curation Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov 01-April-2008: Contacted by JYOTI. Only protein-protein interactions 13 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Accepted 2008-FEB-30 by CDEROW. 01-April-2008: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Cell (0092-8674) 2007 imex curation Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov 01-April-2008: Contacted by JYOTI. Only protein-protein interactions 13 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. immunodepletion immunodepleted coimmunoprecipitation immunodepleted coip immunodepletion weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Accepted 2008-FEB-30 by CDEROW. 01-April-2008: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. Cell (0092-8674) 2007 imex curation Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov 01-April-2008: Contacted by JYOTI. Only protein-protein interactions 13 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Accepted 2008-FEB-30 by CDEROW. 01-April-2008: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation sgmr1_rat Sigma non-opioid intracellular receptor 1 Sigma 1-type opioid receptor Sigmar1 Oprs1 protein protein rat Rattus norvegicus (Rat) Rat MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP B125A0388F1FFC6E sgmr1_mouse Sigma non-opioid intracellular receptor 1 Sigma 1-type opioid receptor Sigmar1 Oprs1 protein protein mouse Mus musculus Mouse MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS 54BB2F14472E3512 bip_crigr Endoplasmic reticulum chaperone BiP HSPA5 78 kDa glucose-regulated protein Binding-immunoglobulin protein GRP78 Heat shock protein 70 family protein 5 Heat shock protein family A member 5 Immunoglobulin heavy chain-binding protein I79_019946 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MKFPMVAAALLLLCAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTSEKDEL 25CF665F59113A49 a0a3l7ikr8_crigr Inositol 1,4,5-trisphosphate receptor CgPICR_020497 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MNEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQGLVSASLRAWPPRPSGLTPALPMPQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVGDKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKITLFMQFRDHLEDVLKGGDVVRLFHAEQEKFLTCDEYRGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEGAQGRTGRRNAGEKIKYRLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDVEEERPIRLMVWALVHGLGPAGACPWPPADPCPSLQLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNDGFISQNDRRQDGRVPLTLYTPQIFGILKAPFRDKGGEGPLVRLEELSDQKNAPYQYMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLHNNRKLLEKHITKTEVETFLERRALGFPSRGQLLSLLLALLTPPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIHEISKQLGVDLLFLCMADEMLPFDLRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNATRDDKKNKFASTMEFVEDYLNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQAPPAMMQAYEEPGGKNVRRSIQGVGHMVSTMVLSRKQSVFGTSGLPAGAGVPEPLDRSKFEDNEDIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTTANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLLHLTMHDYAPLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSVKGEEGEAGATKDKKEQPTDEEGFLQPHGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKGDSKMLEILRYTHQFLQKFCAGNPGNQALLHKHLQLFLTPGLLEAETMQHIFLNNYQLCSEISEPVLQHCVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDMIMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVTVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTGEYPHWTFPGVPCWGHQPHSDHLIPGHECHPGWLPPARVCNKREKRLADPTLEKYVLTVVLDTINAFFSSPFSENSTSLQTHQTIVVQLLQSTTRLLECPWLQQQHKGSVEACVRTLAMVAKSRAILLPMDLDAHMSALLSSGGSCAAAAQRSAANYKTATRTFPRVIPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDVLHWPELLFLEGSEAYQRCESGGFLSKLIRHTKGLMESEEKLCVKVLRTLQQMLLKKNKYGDRGNQLRKMLLQNYLQNRKSSSRGELPDPSGSGLDQDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMTGDKKSERFFRVLHDRMKRAQQETKSTVAVNMSDLGSQPREDREPVDPTTKGRVASFSMPSSSRYSLGPSLHRGREASDRVQSSEMGASVLVMRPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINEDNVSLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISPLCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERENSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQMLKSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRRLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIAFFYPYVEGASTGVLGSPLISLLFWILICFSIAALFTKRYSVRPLIVALILRSIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPENHSRASTLGMPHGTATFVGTCSGDKIDCASEVSVPEILEVDEEPDSTERACDTLLMCIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFVVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSSEGEGEQNEIRILQEKLGSTMKLVSHLTAQLNELKEQVQLGPRGKMPPSPPDEIHLTQMTEQRKRRQRLGFVDVQNCISR a0a3l7i3a5_crigr Sigma 1-type opioid receptor Sigma non-opioid intracellular receptor 1 CgPICR_003176 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MQWSLGRRWAWIALFLAVAAVLTQAVWLWLGTQNFVFQQEEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP bip_rat Endoplasmic reticulum chaperone BiP Hspa5 Grp78 Immunoglobulin heavy chain-binding protein Steroidogenesis-activator polypeptide 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein rat Rattus norvegicus (Rat) Rat MKFTVVAAALLLLCAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSPEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGGPPPTGEEDTSEKDEL 9D686C6484150108 oprs1-grp78-1 5 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait eyfp c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Association of Sig-1RS with BiP Fig 2A, S2E oprs1-grp78-2 2 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Fig 2C As seen in Figure 2C, endogenous Sig-1Rs coimmunoprecipitated BiP, and conversely BiP coimmunoprecipitated endogenous Sig-1Rs. oprs1-grp78-3 6 8 unspecified role unspecified role bait bait eyfp c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role prey prey physical association physical association Association of Sig-1RS with BiP Mg2+/ATP Glucose deprivation Calcium chelator BAPTA Ca2+, Mn2+ Pentazocine SKF-10047 PRE-084; 2-(4-morpholino)ethyl 1-phenylcyclohexane-1-carboxylate hydrochloride Fluoxetine Cocaine (weak) Methamphetamine Pregnenolone sulphate Dehydroepiandrosterone sulphate NE-100; N ,N-dipropyl-2-[4-methoxy-3-(2-phenylethoxy)phenyl]-ethylamine monohydrochloride Figs. 2B, 2D, 2G, 2H, 3A, 3B, 3C Effect of ATP on BiP association with Sig-1R-EYFP oprs1-grp78-4 2 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Fig 2C As seen in Figure 2C, endogenous Sig-1Rs coimmunoprecipitated BiP, and conversely BiP coimmunoprecipitated endogenous Sig-1Rs. oprs1-hspa5-1 3 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait eyfp c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Stable association of Sig-1R-EYFP with BiP: pulse chase plus IP Fig 2F Oprs1 stably associates with Hspa5 over more than 32 hours oprs1-grp78-6 1 12 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 4E Indeed, Sepharose beads coupled to GST-Sig-1Rs 116-223 pulled down BiP in cell lysates from rat organs or CHO cells oprs1-grp78-7 1 12 unspecified role unspecified role prey prey rat-pancreas Rattus norvegicus pancreas 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 4E Indeed, Sepharose beads coupled to GST-Sig-1Rs 116-223 pulled down BiP in cell lysates from rat organs or CHO cells oprs1-grp78-8 1 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 12 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver physical association physical association Fig 4E Indeed, Sepharose beads coupled to GST-Sig-1Rs 116-223 pulled down BiP in cell lysates from rat organs or CHO cells oprs1-grp78-9 1 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig 4E, 4F Indeed, Sepharose beads coupled to GST-Sig-1Rs 116-223 pulled down BiP in cell lysates from rat organs or CHO cells Ca2+, Mn2+ oprs1-itpr3-1 2 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig 6A Coimmmunoprecipitation of IP3R3 with endogenous immunoreactive Sig-1R or Sig-1R EYFP. Data from NG-108 cells not added as this is a mouse/rat hybidoma so I have no idea which species to attribute the proteins to oprs1-itpr3-2 6 11 unspecified role unspecified role bait bait eyfp c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey physical association physical association Fig 6A, 6D Coimmmunoprecipitation of IP3R3 with endogenous immunoreactive Sig-1R or Sig-1R EYFP. Thapsigargin (inhibitor of sarco-endoplasmic reticulum Ca2+-ATPases) BAPTA-AM - calcium chelator oprs1-itpr3-3 4 11 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 6A Images represent colocalization of IP3R3 and endogenous Sig-1Rs at MAM in a CHO cell. oprs1-itpr3-4 6 11 unspecified role unspecified role bait bait eyfp c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Fig 6C ATP - inhibited binding of Gpr78 but not Itpr3 Thapsigargin (endoplasmic reticulum stress factor) BAPTA-AM calcium chelator