IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. Science (0036-8075) 2007 imex curation Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Accepted 2007-DEC-15 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Science (0036-8075) 2007 orchard Only protein-protein interactions imex curation FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. Science (0036-8075) 2007 imex curation Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Accepted 2007-DEC-15 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Science (0036-8075) 2007 orchard Only protein-protein interactions imex curation FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. Science (0036-8075) 2007 imex curation Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Accepted 2007-DEC-15 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Science (0036-8075) 2007 orchard Only protein-protein interactions imex curation FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. Science (0036-8075) 2007 imex curation Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Accepted 2007-DEC-15 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Science (0036-8075) 2007 orchard Only protein-protein interactions imex curation FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. Science (0036-8075) 2007 imex curation Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Accepted 2007-DEC-15 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Science (0036-8075) 2007 orchard Only protein-protein interactions imex curation FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. Science (0036-8075) 2007 imex curation Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Accepted 2007-DEC-15 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Science (0036-8075) 2007 orchard Only protein-protein interactions imex curation FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. Science (0036-8075) 2007 imex curation Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Accepted 2007-DEC-15 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Science (0036-8075) 2007 orchard Only protein-protein interactions imex curation FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. Science (0036-8075) 2007 imex curation Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Accepted 2007-DEC-15 by ORCHARD. Science (0036-8075) 2007 orchard Only protein-protein interactions imex curation gigan_arath Protein GIGANTEA GI At1g22770 T22J18.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTERNCLSKATTSGSPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIASRGSGKHPQLMPSTPRWAVANGAGVILSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATPSATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIAMSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAEATIEATAQGIASMLCAHGPEVEWRICTIWEAAYGLIPLNSSAVDLPEIIVATPLQPPILSWNLYIPLLKVLEYLPRGSPSEACLMKIFVATVETILSRTFPPESSRELTRKARSSFTTRSATKNLAMSELRAMVHALFLESCAGVELASRLLFVVLTVCVSHEAQSSGSKRPRSEYASTTENIEANQPVSNNQTANRKSRNVKGQGPVAAFDSYVLAAVCALACEVQLYPMISGGGNFSNSAVAGTITKPVKINGSSKEYGAGIDSAISHTRRILAILEALFSLKPSSVGTPWSYSSSEIVAAAMVAAHISELFRRSKALTHALSGLMRCKWDKEIHKRASSLYNLIDVHSKVVASIVDKAEPLEAYLKNTPVQKDSVTCLNWKQENTCASTTCFDTAVTSASRTEMNPRGNHKYARHSDEGSGRPSEKGIKDFLLDASDLANFLTADRLAGFYCGTQKLLRSVLAEKPELSFSVVSLLWHKLIAAPEIQPTAESTSAQQGWRQVVDALCNVVSATPAKAAAAVVLQAERELQPWIAKDDEEGQKMWKINQRIVKVLVELMRNHDRPESLVILASASDLLLRATDGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHPSAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFNAASIDWKADIQNCLNWEAHSLLSTTMPTQFLDTAARELGCTISLSQ DIP protein Q9SQI2 original sequence version: 85 DIP protein Q9SQI2 original sequence version: 78 71CFDE7D39E73549 srk2g_arath Serine/threonine-protein kinase SRK2G SRK2G At5g08590 MAH20.15 ASK2 OSKL8 SNRK2.1 Arabidopsis protein SK1 OST1-kinase-like 8 SNF1-related kinase 2.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDKYDVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNIIRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQICHRDLKLENTLLDGSPAPLLKICDFGYSKSSILHSRPKSTVGTPAYIAPEVLSRREYDGKHADVWSCGVTLYVMLVGAYPFEDPNDPKNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKNHPWYLKNLPKELLESAQAAYYKRDTSFSLQSVEDIMKIVGEARNPAPSTSAVKSSGSGADEEEEEDVEAEVEEEEDDEDEYEKHVKEAQSCQESDKA 7176CE43659FCCA4 cdf1_arath Cyclic dof factor 1 CDF1 DOF5.5 Dof zinc finger protein DOF5.5 K19B1.4 MMI9.24 At5g62430 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLETKDPAIKLFGMKIPFPTVLEVADEEEEKNQNKTLTDQSEKDKTLKKPTKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPIGAGRRKNKNNSPTSHYHHVTISETNGPVLSFSLGDDQKVSSNRFGNQKLVARIENNDERSNNNTSNGLNCFPGVSWPYTWNPAFYPVYPYWSMPVLSSPVSSSPTSTLGKHSRDEDETVKQKQRNGSVLVPKTLRIDDPNEAAKSSIWTTLGIKNEVMFNGFGSKKEVKLSNKEETETSLVLCANPAALSRSINFHEQM 683CEB24D4F22D75 ado3_arath Adagio protein 3 ADO3 Flavin-binding kelch repeat F-box protein 1 F-box only protein 2a At1g68050 FKF1 T23K23.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAREHAIGEATGKRKKRGRVEEAEEYCNDGIEEQVEDEKLPLEVGMFYYPMTPPSFIVSDALEPDFPLIYVNRVFEVFTGYRADEVLGRNCRFLQYRDPRAQRRHPLVDPVVVSEIRRCLEEGIEFQGELLNFRKDGTPLVNRLRLAPIRDDDGTITHVIGIQVFSETTIDLDRVSYPVFKHKQQLDQTSECLFPSGSPRFKEHHEDFCGILQLSDEVLAHNILSRLTPRDVASIGSACRRLRQLTKNESVRKMVCQNAWGKEITGTLEIMTKKLRWGRLARELTTLEAVCWRKFTVGGIVQPSRCNFSACAVGNRLVLFGGEGVNMQPLDDTFVLNLDAECPEWQRVRVTSSPPGRWGHTLSCLNGSWLVVFGGCGRQGLLNDVFVLDLDAKHPTWKEVAGGTPPLPRSWHSSCTIEGSKLVVSGGCTDAGVLLSDTFLLDLTTDKPTWKEIPTSWAPPSRLGHSLSVFGRTKILMFGGLANSGHLKLRSGEAYTIDLEDEEPRWRELECSAFPGVVVPPPRLDHVAVSMPCGRVIIFGGSIAGLHSPSQLFLIDPAEEKPSWRILNVPGKPPKLAWGHSTCVVGGTRVLVLGGHTGEEWILNELHELCLASRQDSDL DIP protein Q9C9W9 original sequence version: 93 AC90C0641149A3D8 fkf1-gi-3 8 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association 1A Interaction between FKF1 and GI proteins in yeast. LOV+F contains LOV and F-box domains. F+kelch contains F-box and kelch repeat domains fkf1-ask2 8 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1A Interaction between FKF1 and GI proteins in yeast. LOV+F contains LOV and F-box domains. F+kelch contains F-box and kelch repeat domains (7). ASK2 is known to interact with F-box domain. fkf1-gi-4 3 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B 1C In the 35S::HA-FKF1 35S::GI-TAP #18 / fkf1 line, a similar amount of GI-TAP protein was precipitated at every time point in both long-day (16 hours light/8 hours dark) and short-day (8 hours light/16hours dark) conditions The authors note that "In both day-length conditions, the amount of coimmunoprecipitated HA-FKF1 protein increased until 4 hours after light onset, remained constant for the rest of day, and declined in the dark (Fig. 1, B and C), suggesting that light or the circadian clock modulate the FKF1 and GI interaction.". fkf1-gi-5 4 9 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S2 A minimal amount of HA-FKF1 was coimmunoprecipitated with GI-TAP protein in the dark white light The minimal amount of coimmunoprecipitated proetins in dark grown material and subseqeunt increase when the dark grown plants were exposed to light indicated that this interaction is light dependent. fkf1-gi-6 1 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1E Similar amounts of FKF1 and GI interacted in blue-light irradiated samples (Fig. 1E) compared to whitelight grown samples, but little interaction was observed in red-light irradiated samples (Fig. 1E), indicating that blue light induces this interaction. blue light the authors concluded that "blue light induces this interaction". fkf1-gi-7 7 9 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1F Similar amounts of FKF1 and GI interacted in blue-light irradiated samples (Fig. 1E) compared to whitelight grown samples, but little interaction was observed in red-light irradiated samples (Fig. 1E), indicating that blue light induces this interaction. Further analysis revealed that the FKF1 and GI interaction is fluence rate-dependent blue light There seemed to be a direct correlation between increasing fluence of blue light and affinity of the GI protein for the FKF1 protein. fkf1-gi-8 6 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9C9W9:p.Cys91Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C A Wed May 02 20:08:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys91ala' Tue Jun 30 16:13:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys91Ala' Q9C9W9:p.Arg92Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R D Wed May 02 15:39:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg92asp' Tue Jun 30 19:42:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg92Asp' Q9C9W9:p.Gln163Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 17:52:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln163leu' Tue Jun 30 17:45:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln163Leu' 9 unspecified role unspecified role bait bait n terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association 1G S3 FKF1-HA protein was co-purified with the glutathione S-transferase fused GI N-terminus (GSTGI- N) protein incubated under light white light The interaction appeared to be light dependent and mediated through the region 91 to 163 since mutations in amino acids withing this region decreased interaction level to that observed in dark grown plants or abolished interaction completely. fkf1-gi-9 2 9 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2 In long days, the peak expression of FKF1 and GI proteins coincided (Fig. 2A). The HA-FKF1 and GI-TAP interaction was observed in the late afternoon (Fig. 2A), when daytime CO expression occurs (Fig. 2E) (4, 13). In short days, HA-FKF1 peaked about 3 hours later than the GI-TAP peak expression, and the FKF1 and GI interaction occurred only at the beginning of the FKF1 expression period (Fig. 2B). In long days HA-FKF1 and GI-TAP interaction was observed in after 10 hours after the light period began. In short days the FKF1 and GI interaction occurred only at the beginning of the FKF1 expression period at 7 hours after the light period began. cdf1-gi 8 9 unspecified role unspecified role bait bait n terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey physical association physical association S10 Interaction between GI and CDF1 in yeast and in vitro. gi-cdf1-1 5 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A In plant materials harvested in the morning, HA-CDF1 was coimmunoprecipitated with GI-TAP (Fig. 3A). cdf1-gi-1 6 9 unspecified role unspecified role bait bait n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S10 Interaction between GI and CDF1 in yeast and in vitro.