IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Arabidopsis JACKDAW and MAGPIE zinc finger proteins delimit asymmetric cell division and stabilize tissue boundaries by restricting SHORT-ROOT action. Arabidopsis JACKDAW and MAGPIE zinc finger proteins delimit asymmetric cell division and stabilize tissue boundaries by restricting SHORT-ROOT action. Genes Dev. (0890-9369) 2007 imex curation Welch D., Hassan H., Blilou I., Immink R., Heidstra R., Scheres B. A Split-YFP analysis was carried out; the coding sequence of Enhanced Yellow Fluorescence Protein (EYFP, Clontech Laboratories) was fragmented into an N-terminal domain of 154 amino acids (YFP/N) and a C-terminal domain of 84 amino acids (YFP/C). b.scheres@bio.uu.nl 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions allce Allium cepa (Onion) Onion bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Welch D., Hassan H., Blilou I., Immink R., Heidstra R., Scheres B. A Split-YFP analysis was carried out; the coding sequence of Enhanced Yellow Fluorescence Protein (EYFP, Clontech Laboratories) was fragmented into an N-terminal domain of 154 amino acids (YFP/N) and a C-terminal domain of 84 amino acids (YFP/C). b.scheres@bio.uu.nl Accepted 2007-Not a month!-19 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Genes Dev. (0890-9369) 2007 orchard Only protein-protein interactions imex curation Arabidopsis JACKDAW and MAGPIE zinc finger proteins delimit asymmetric cell division and stabilize tissue boundaries by restricting SHORT-ROOT action. Arabidopsis JACKDAW and MAGPIE zinc finger proteins delimit asymmetric cell division and stabilize tissue boundaries by restricting SHORT-ROOT action. Genes Dev. (0890-9369) 2007 imex curation Welch D., Hassan H., Blilou I., Immink R., Heidstra R., Scheres B. A Split-YFP analysis was carried out; the coding sequence of Enhanced Yellow Fluorescence Protein (EYFP, Clontech Laboratories) was fragmented into an N-terminal domain of 154 amino acids (YFP/N) and a C-terminal domain of 84 amino acids (YFP/C). b.scheres@bio.uu.nl 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Welch D., Hassan H., Blilou I., Immink R., Heidstra R., Scheres B. A Split-YFP analysis was carried out; the coding sequence of Enhanced Yellow Fluorescence Protein (EYFP, Clontech Laboratories) was fragmented into an N-terminal domain of 154 amino acids (YFP/N) and a C-terminal domain of 84 amino acids (YFP/C). b.scheres@bio.uu.nl Accepted 2007-Not a month!-19 by ORCHARD. Genes Dev. (0890-9369) 2007 orchard Only protein-protein interactions imex curation idd3_arath Zinc finger protein MAGPIE MGP IDD3 Protein indeterminate-domain 3 F11M21.23 At1g03840 PSG3 Protein POLLEN SPECIFIC GENE 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTTEDQTISSSGGYVQSSSTTDHVDHHHHDQHESLNPPLVKKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCEKCAKRYAVQSDWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDALAEETARLNAASHLKSFAATAGSNLNYHYLMGTLIPSPSLPQPPSFPFGPPQPQHHHHHQFPITTNNFDHQDVMKPASTLSLWSGGNINHHQQVTIEDRMAPQPHSPQEDYNWVFGNANNHGELITTSDSLITHDNNINIVQSKENANGATSLSVPSLFSSVDQITQDANAASVAVANMSATALLQKAAQMGATSSTSPTTTITTDQSAYLQSFASKSNQIVEDGGSDRFFASFGSNSVELMSNNNNGLHEIGNPRNGVTVVSGMGELQNYPWKRRRVDIGNAGGGGQTRDFLGVGVQTICHSSSINGWI C27006B44C77D1C7 shr_arath Protein SHORT-ROOT SHR SGR7 Protein SHOOT GRAVITROPISM 7 At4g37650 F19F18.140 GRAS family protein 26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTLFRLVSLQQQQQSDSIITNQSSLSRTSTTTTGSPQTAYHYNFPQNDVVEECFNFFMDEEDLSSSSSHHNHHNHNNPNTYYSPFTTPTQYHPATSSTPSSTAAAAALASPYSSSGHHNDPSAFSIPQTPPSFDFSANAKWADSVLLEAARAFSDKDTARAQQILWTLNELSSPYGDTEQKLASYFLQALFNRMTGSGERCYRTMVTAAATEKTCSFESTRKTVLKFQEVSPWATFGHVAANGAILEAVDGEAKIHIVDISSTFCTQWPTLLEALATRSDDTPHLRLTTVVVANKFVNDQTASHRMMKEIGNRMEKFARLMGVPFKFNIIHHVGDLSEFDLNELDVKPDEVLAINCVGAMHGIASRGSPRDAVISSFRRLRPRIVTVVEEEADLVGEEEGGFDDEFLRGFGECLRWFRVCFESWEESFPRTSNERLMLERAAGRAIVDLVACEPSDSTERRETARKWSRRMRNSGFGAVGYSDEVADDVRALLRRYKEGVWSMVQCPDAAGIFLCWRDQPVVWASAWRPT F43EEC5F7AA0CA1C scr_arath Protein SCARECROW SCR At3g54220 GRAS family protein 20 SGR1 Protein SHOOT GRAVITROPISM 1 F24B22.180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAESGDFNGGQPPPHSPLRTTSSGSSSSNNRGPPPPPPPPLVMVRKRLASEMSSNPDYNNSSRPPRRVSHLLDSNYNTVTPQQPPSLTAAATVSSQPNPPLSVCGFSGLPVFPSDRGGRNVMMSVQPMDQDSSSSSASPTVWVDAIIRDLIHSSTSVSIPQLIQNVRDIIFPCNPNLGALLEYRLRSLMLLDPSSSSDPSPQTFEPLYQISNNPSPPQQQQQHQQQQQQHKPPPPPIQQQERENSSTDAPPQPETVTATVPAVQTNTAEALRERKEEIKRQKQDEEGLHLLTLLLQCAEAVSADNLEEANKLLLEISQLSTPYGTSAQRVAAYFSEAMSARLLNSCLGIYAALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHFTANQAIQEAFEKEDSVHIIDLDIMQGLQWPGLFHILASRPGGPPHVRLTGLGTSMEALQATGKRLSDFADKLGLPFEFCPLAEKVGNLDTERLNVRKREAVAVHWLQHSLYDVTGSDAHTLWLLQRLAPKVVTVVEQDLSHAGSFLGRFVEAIHYYSALFDSLGASYGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFESWREKMQQCGFKGISLAGNAATQATLLLGMFPSDGYTLVDDNGTLKLGWKDLSLLTASAWTPRS 009A4C48C6DA0616 ath1_arath Homeobox protein ATH1 ATH1 At4g32980 F26P21.100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNNNNNNTFSSLDNVMTNQNPLLMDFIPSREDSTSFSTMLPWNTIRSDPLQMGGFDIFNSMLTNKYLSSSPRSIDVQDNRNVEFMAPPPHPPPLHPLDHLRHYDDSSNNMWGFEANSEFQAFSGVVGPSEPMMSTFGEEDFPFLISNKRNNELSLSLASDVSDECSEISLCAATRLASEQASCSSKDISNNVVTQGFSQLIFGSKYLHSVQEILSHFAAYSLDYSSRGTESGAASSAFTSRFENITEFLDGDSNNSEAGFGSTFQRRALEAKKTHLLDLLQMVDDRYSHCVDEIHTVISAFHAATELDPQLHTRFALQTVSFLYKNLRERICKKIISMGSVLERGKDKTQETSMFHQHCLLQQLKRKNHQIWRPQRGLPEKSVSVLRNWMFQNFLHPYPKDSEKHLLAIRSGLTRSQVSNWFINARVRLWKPMIEEMYAEMNKRKLNNSHIQPNGPTLRMPKSVMMSQAMHK ADF8B1DBCA16A10F stm_arath Homeobox protein SHOOT MERISTEMLESS At1g62360 F2401.9 STM protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESGSNSTSCPMAFAGDNSDGPMCPMMMMMPPIMTSHQHHGHDHQHQQQEHDGYAYQSHHQQSSSLFLQSLAPPQGTKNKVASSSSPSSCAPAYSLMEIHHNEIVAGGINPCSSSSSSASVKAKIMAHPHYHRLLAAYVNCQKVGAPPEVVARLEEACSSAAAAAASMGPTGCLGEDPGLDQFMEAYCEMLVKYEQELSKPFKEAMVFLQRVECQFKSLSLSSPSSFSGYGETAIDRNNNGSSEEEVDMNNEFVDPQAEDRELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSEQQKLALAESTGLDQKQINNWFINQRKRHWKPSEDMQFVVMDATHPHHYFMDNVLGNPFPMDHISSTML 6227D3DE4093E732 idd10_arath Zinc finger protein JACKDAW IDZ3 ID1-like zinc finger protein 3 IDD10 Protein indeterminate-domain 10 JKD F15A17.180 MOK16.6 At5g03150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQMIPGDPFSISSSMGGFVHQETHLHHLQQQIPDLNPNSNPNPNAKPNSSSAKKKRNQPGTPDPDADVIALSPTTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRSKQEVIKKKVYICPIKTCVHHDASRALGDLTGIKKHYSRKHGEKKWKCEKCSKKYAVQSDWKAHAKTCGTREYKCDCGTLFSRKDSFITHRAFCDALTEEGARMSSLSNNNPVISTTNLNFGNESNVMNNPNLPHGFVHRGVHHPDINAAISQFGLGFGHDLSAMHAQGLSEMVQMASTGNHHLFPSSSSSLPDFSGHHQFQIPMTSTNPSLTLSSSSTSQQTSASLQHQTLKDSSFSPLFSSSSENKQNKPLSPMSATALLQKAAQMGSTRSNSSTAPSFFAGPTMTSSSATASPPPRSSSPMMIQQQLNNFNTNVLRENHNRAPPPLSGVSTSSVDNNPFQSNRSGLNPAQQMGLTRDFLGVSNEHHPHQTGRRPFLPQELARFAPLG 49F387E021AB0A97 jkd1-jkd1 2 8 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 6, Supplementary Figure 3 JKD1 could interact with itself and with both SCR and MGP1. We detected weak interaction between SCR and MGP1 but no self interaction for MGP and SCR. jkd1-shr 2 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 6, Supplementary Figure 3 In pairwise combinations we found that SHR interacted with JKD1 and MGP1 jkd1-scr 2 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 6, Supplementary Figure 3 JKD1 could interact with itself and with both SCR and MGP1. jkd1-mgp1 2 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey physical association physical association Figure 6, Supplementary Figure 3 JKD1 could interact with itself and with both SCR and MGP1. mgp1-jkd1 2 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association Figure 6, Supplementary Figure 3 JKD1 could interact with itself and with both SCR and MGP1. mgp1-scr 2 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association Figure 6, Supplementary Figure 3 We detected weak interaction between SCR and MGP1 The authors decribe the interaction between the two proteins as 'weak'. mgp1-shr 2 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association Figure 6, Supplementary Figure 3 In pairwise combinations we found that SHR interacted with JKD1 and MGP1 scr-shr-8 2 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Supplementary Figure 3 Next, we confirmed that SHR interacted strongly with SCR shr-shr 2 5 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Supplementary Figure 3 scr-mgp1 2 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Supplementary Figure 3 JKD1 could interact with itself and with both SCR shr-mgp1 2 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Supplementary Figure 3 jkd1-jkd1-1 1 8 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary Table 2 It was not possible to assign EYFP N-terminal and EYFP C-terminal tags to the proteins as this is not made clear in the text. The author has not responded to email requests for information. jkd1-mgp1-1 1 3 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary Table 2 It was not possible to assign EYFP N-terminal and EYFP C-terminal tags to the proteins as this is not made clear in the text. The author has not responded to email requests for information. jkd1-scr-1 1 8 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary Table 2 It was not possible to assign EYFP N-terminal and EYFP C-terminal tags to the proteins as this is not made clear in the text. The author has not responded to email requests for information. jkd1-shr-1 1 8 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary Table 2 It was not possible to assign EYFP N-terminal and EYFP C-terminal tags to the proteins as this is not made clear in the text. The author has not responded to email requests for information. shr-stm 1 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary Table 2 It was not possible to assign EYFP N-terminal and EYFP C-terminal tags to the proteins as this is not made clear in the text. The author has not responded to email requests for information. stm-ath1-3 1 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary Table 2 It was not possible to assign EYFP N-terminal and EYFP C-terminal tags to the proteins as this is not made clear in the text. The author has not responded to email requests for information.