IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ BH3 profiling identifies three distinct classes of apoptotic blocks to predict response to ABT-737 and conventional chemotherapeutic agents. BH3 profiling identifies three distinct classes of apoptotic blocks to predict response to ABT-737 and conventional chemotherapeutic agents. Cancer Cell (1535-6108) 2007 imex curation Deng J., Carlson N., Takeyama K., Dal Cin P., Shipp M., Letai A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer anthony_letai@dfci.harvard.edu Only protein-protein interactions 2 human-sudhl-4 human sudhl-4 sudhl-4 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Deng J., Carlson N., Takeyama K., Dal Cin P., Shipp M., Letai A. Apoptosis - Interactions involving proteins with a function related to apoptosis anthony_letai@dfci.harvard.edu Accepted 2007-OCT-14 by JYOTI. Cancer Cell (1535-6108) 2007 Only protein-protein interactions 2 imex curation bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB o43521-2 Bcl-2-like protein 11 Bim(L) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH 8BB4AAE06CB080FA o43521-1 Bcl-2-like protein 11 Bim(EL) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH D75735E469CA6997 bcl2-bim 1 4 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association 2 F BIM was present in high levels in SU-DHL4 and SU-DHL6, and it was likewise sequestered in a complex with BCL-2. Three isoforms of BIM, BIM-EL, BIM-L and BIM-S, were coimmunoprecipitated with Bcl-2. The isoform BIM-S is not contained in the UniProtKB entry for this protein and so cannot be added as an interactor. bcl2-bim-1 1 2 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 2 F BIM was present in high levels in SU-DHL4 and SU-DHL6, and it was likewise sequestered in a complex with BCL-2. Three isoforms of BIM, BIM-EL, BIM-L and BIM-S, were coimmunoprecipitated with Bcl-2. The isoform BIM-S is not contained in the UniProtKB entry for this protein and so cannot be added as an interactor.