MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it AChBP-targeted alpha-conotoxin correlates distinct binding orientations with nAChR subtype selectivity. AChBP-targeted alpha-conotoxin correlates distinct binding orientations with nAChR subtype selectivity. EMBO J. (0261-4189) 2007 imex curation Dutertre S., Ulens C., Büttner R., Fish A., van Elk R., Kendel Y., Hopping G., Alewood PF., Schroeder C., Nicke A., Smit AB., Sixma TK., Lewis RJ. 2009-01-08 Only protein-protein interactions in vitro In vitro saturation binding saturation binding predetermined predetermined participant predetermined Dutertre S., Ulens C., Büttner R., Fish A., van Elk R., Kendel Y., Hopping G., Alewood PF., Schroeder C., Nicke A., Smit AB., Sixma TK., Lewis RJ. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation AChBP-targeted alpha-conotoxin correlates distinct binding orientations with nAChR subtype selectivity. AChBP-targeted alpha-conotoxin correlates distinct binding orientations with nAChR subtype selectivity. EMBO J. (0261-4189) 2007 imex curation Dutertre S., Ulens C., Büttner R., Fish A., van Elk R., Kendel Y., Hopping G., Alewood PF., Schroeder C., Nicke A., Smit AB., Sixma TK., Lewis RJ. 2009-01-08 Only protein-protein interactions in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Dutertre S., Ulens C., Büttner R., Fish A., van Elk R., Kendel Y., Hopping G., Alewood PF., Schroeder C., Nicke A., Smit AB., Sixma TK., Lewis RJ. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation 3l21a_bunmu Alpha-bungarotoxin Long neurotoxin 1 Alpha-bungarotoxin, isoform A31 Alpha-elapitoxin-Bm2a protein protein bunmu Bungarus multicinctus Many-banded krait MKTLLLTLVVVTIVCLDLGYTIVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG mint Produces peripheral paralysis by blocking neuromuscular transmission at the postsynaptic site. Binds to muscular and neuronal (alpha-7, alpha-8, and alpha-9) nicotinic acetylcholine receptors. Blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 uM) 589B26743ABBA5E4 ca11_conte Alpha-conotoxin-like Tx1 protein protein conte Conus textile MGMRMMFVVFLLVVLASTVVSSTSGRRAFHGRNAAAKASGLVSLTDRRPECCSDPRCNSSHPELCGGRR mint Alpha-conotoxins act on postsynaptic membranes, they bind to the nicotinic acetylcholine receptors (nAChR) and thus inhibit them E36ECE90BF1B56B0 achp_lymst Acetylcholine-binding protein protein protein lymst Lymnaea stagnalis Helix stagnalis MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL DIP protein P58154 original sequence version: 78 mint Binds to acetylcholine. Modulates neuronal synaptic transmission B76A3A13E7EF8FCB achp-cax1 2 conotoxin 1a 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified AChBP 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f1d mint achp-nxl1a 1 bungarotoxin 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified aChBP 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f1c kd 3.5 nanomolar mint