IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Anchorage of plant RanGAP to the nuclear envelope involves novel nuclear-pore-associated proteins. Anchorage of plant RanGAP to the nuclear envelope involves novel nuclear-pore-associated proteins. Curr. Biol. (0960-9822) 2007 imex curation Xu XM., Meulia T., Meier I. Transgenic Arabidopsis (ecotype Columbia) plants expressing epitope tagged proteins were used in this study. meier.56@osu.edu jyoti Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xu XM., Meulia T., Meier I. Transgenic Arabidopsis (ecotype Columbia) plants expressing epitope tagged proteins were used in this study. meier.56@osu.edu Accepted 2009-MAY-20 by JYOTI. Curr. Biol. (0960-9822) 2007 jyoti Only protein-protein interactions imex curation Anchorage of plant RanGAP to the nuclear envelope involves novel nuclear-pore-associated proteins. Anchorage of plant RanGAP to the nuclear envelope involves novel nuclear-pore-associated proteins. Curr. Biol. (0960-9822) 2007 imex curation Xu XM., Meulia T., Meier I. Transgenic Arabidopsis (ecotype Columbia) plants expressing epitope tagged proteins were used in this study. meier.56@osu.edu jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu XM., Meulia T., Meier I. Transgenic Arabidopsis (ecotype Columbia) plants expressing epitope tagged proteins were used in this study. meier.56@osu.edu Accepted 2009-MAY-20 by JYOTI. Curr. Biol. (0960-9822) 2007 jyoti Only protein-protein interactions imex curation Anchorage of plant RanGAP to the nuclear envelope involves novel nuclear-pore-associated proteins. Anchorage of plant RanGAP to the nuclear envelope involves novel nuclear-pore-associated proteins. Curr. Biol. (0960-9822) 2007 imex curation Xu XM., Meulia T., Meier I. Transgenic Arabidopsis (ecotype Columbia) plants expressing epitope tagged proteins were used in this study. meier.56@osu.edu jyoti Only protein-protein interactions tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Xu XM., Meulia T., Meier I. Transgenic Arabidopsis (ecotype Columbia) plants expressing epitope tagged proteins were used in this study. meier.56@osu.edu Accepted 2009-MAY-20 by JYOTI. Curr. Biol. (0960-9822) 2007 jyoti Only protein-protein interactions imex curation wip1_arath WPP domain-interacting protein 1 WIP1 M3E9.120 At4g26455 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLESESSALESVDDNVLIQQSASNVCDDGRSLDNGSCSDESVKLLSTSNSVELGKPMSFDSPGDGGGAYSPVLKGQGLRKWRRIRRDLVKDTSANMENSKALKRGLSGVAHSHGKQMQFQSPEVEQESQGSVGSVNMLKSSGDGFDILGSSGYDSRFVAGVGFSAGMDLEIDDDRSSKSSTVARAPKVIRYEKPMISSGQGGNIRVENSKKHRGESVDFEKENSYSSLESDSRKQSGRMMDYNGENGETSMRKDDAGGEGGESINTDNRYSDEMDPLTEAINGFLALQDALEKEVQQFQEIGNEPMPQHHEQVSEANSPHPEIVTLVNNVEQLENMLEETRSMLEVKESHIRDLESTTNQSKHSWGGTEIVVEDIFRQKIEAEIEYLIYSRSIDNLNSQMKLIDEQESLAEEQTHETLNKLGRVQTKAANFTNRAQDLQNDCIEITGTIKKRACKITSYVLIQLVLLSTVVLLLLSQLLPEPDTVVPT DIP protein Q8GXA4 original sequence version: 18 3DCD663768750292 ragp1_arath RAN GTPase-activating protein 1 RANGAP1 At3g63130 T20O10.230 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDHSAKTTQNRVLSVKMWPPSKSTRLMLVERMTKNITTPSIFSRKYGLLSVEEAEQDAKRIEDLAFATANKHFQNEPDGDGTSAVHVYAKESSKLMLDVIKRGPQEESEVEVSKDGDVFFDISGGSRAFIEEEEARDLLRPLADPRNSYTKIRFSNRSFGSEAAKFAASVLSSIKDQLTEVDLSDFVAGRPEAEALEVMNMFSSALEGSKLRYLNLSDNALGEKGIRAFASLINSQHDLEELYLMNDGISEDAARAVRELLPSTDKIRVLQFHNNMTGDEGATAIAEIVRECPSLEDFRCSSTRIGSEGGVALAEALEHCSHLKKLDLRDNMFGVEGGIALAKTLSVLTHLTEIYMSYLNLEDEGTEALSEALLKSAPSLEVLELAGNDITVKSTGNLAACIASKQSLAKLNLSENELKDEGTILIAKAVEGHDQLVEVDLSTNMIRRAGARALAQTVVKKNTFKLLNINGNFISEEGIDEVNDMFKDCLDKLVPLDDNDPEGEDFEDEDEEEEGEDGNELESKLGSLKIKQGEE DIP protein Q9LE82 original sequence version: 48 06CA71980A007BEB wip2_arath WPP domain-interacting protein 2 At5g56210 WIP2 K24C1.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLESESSVLESVEDNNGLIGDLDKELNSPVETSPLISKGFGLRKWKRRLRRDLVKDDTSVSMENSKALKRVLSGLVDPNAKQMHLPGPEVRQDSVGSVGSVNSVVGFVMGGESYGNGLAFAAGVDSDNSEDRSSTMSHSWDKHRGKVSGGKSVISSGDSSQQRKSSVEKSNKLRGERIKIEKENSHSSMESADSRSSNFVFMQGASYSLSSREQGGRRMMDYDDENSDHDAHTSKRKDNVEEEEEETEDYSQGDCVEESQIKSNGSSDNLDPLIVAVNSFQTLQEALQKELQKFQELGKEEPITSLHDGGESSSCIHAGHEGASEASSSYRFGSEKMGEMELTSLDSEILNLVNNVEHLEIKLEEAKRILEVKETQIRELESTINVSETCNGGTEIGIEDIFQQKVEAEIEYIIFSRSVGNLKRRIKLIEEEKTLGLSKLDKAETKAENLKNQAQDLQNHCVEITEIQEVECLKKRAFKTTRCLLLQLGLLFILYYSLLPEPEIAVPT 28500632BE3A4EBB wip3_arath WPP domain-interacting protein 3 At3g13360 WIP3 MDC11.15 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNESVPDSVEDNGNSVPANGLLVLPDNDHEEGGVGSPQRSNSVESPGGSVHSTRKGFGLKKWRRIKRDGPVRDEAAPVDDGSKLLKRGLAGLVNPPSKHVEFSSVEARQSSEGSVGSVNMVHHPGVANGFSPDIGCMFAVGQAFEKSEEHSGNTIGGKNVVGGKVVSGSQEKLWSDTIKRASEERGDIEKEKPCSSLDSDLRSSDFVFSTGSVSVGNHGEKDERLTMNYIGGFSNEGQVKEEVQTYSRSENGNKEDDGESKKNNNHWADKDALADSIRSFAVLQEVLWKEVQSFQELGKESVLLHSNTDELSSDQPSHQNCKEDNSTSSGSKALILKEKVKLLEHKLEEARAALEAKEARIQELENSKIESELECIFQRKIETEIEHLMLTRSLSSLQVLQETKKLHSLKEDPVSNRGNILGKTCKLGFYILTQLILLVSILRFLVLQFSPASRLVIPT 6FAD2C63953AAC07 ragp2_arath RAN GTPase-activating protein 2 RANGAP2 F7K24.70 At5g19320 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADILDSRPHAFSIKLWPPSLPTRKALIERITNNFSSKTIFTEKYGSLTKDQATENAKRIEDIAFSTANQQFEREPDGDGGSAVQLYAKECSKLILEVLKKGPVAKVAARELISEDSVSPRETFFDISKGKRAFIEAEEAEELLKPLKEPGNAYTKICFSNRSFGLGAARVAEPILASLKDQLKEVDLSDFVAGRPELEALEVMNIFSDALQGSILSSLNLSDNALGEKGVRAFGALLKSLSSLEELYLMNDGISKEAAQAVSELIPSTENLRVLHFHNNMTGDEGALAIAEVVKRSPLLENFRCSSTRVGSKGGIALSEALEHCTHMEKLDLRDNMFGTEAGVSLSKTLSSFKHMTELYLSYLNLEDEGAIAIVNALKESASPIEVLEMAGNDITVEAASAIAACVAAKQDLNKLNLSENELKDEGCVQIANCIEEGHSKLQYIDMSTNYIRRAGARALAHVVVKKEAFKLLNIDGNIISEEGIEELKEIFKKSPELLGALDENDPDGEEDDDDEEDEEDEENEGNGNGELESKLKNLEVNQED 9484A095ECCC36F9 wpp2_arath WPP domain-containing protein 2 WPP2 F8G22.9 At1g47200 MAF2 MFP1 attachment factor 2 F2G19.18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAETAETINTTISSPPPESESSTTISAMTDPTSQEAASKDTDLTKEAESEKKPGGISLRIWPPTQKTRDAVLNRLIETLSTESILSKRYGTLKSDDATTVAKLIEEEAYGVASNAVSSDDDGIKILELYSKEISKRMLESVKARSNASVGNGSVEDANTDASEVSKDDAGPASEEEKSEA F71F090976FA3826 wpp1_arath WPP domain-containing protein 1 At5g43070 WPP1 MAF1 MFP1 attachment factor 1 MMG4.9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAETETESITTSSPPPISETENSTTLPTTETEKNPNPVTISLRIWPPTQKTRDAVINRLIETLSTESILSKRFGSLESEEASSVAKSIEDEAYAIASATVFGDDDGIEILKAYSKEISKRMLESVKAKSNVASPPPKDGDGIESAVDSKIDSSEA A50DCCA4511B8484 at3g63130-at4g26450 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 1B Coimmunoprecipitation (co-IP) from either RanGAP1- GFP or GFP-WIP1 transgenic Arabidopsis plants confirmed the interaction between RanGAP1 and WIP1 in vivo at4g26450-at3g63130 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 1B Coimmunoprecipitation (co-IP) from either RanGAP1- GFP or GFP-WIP1 transgenic Arabidopsis plants confirmed the interaction between RanGAP1 and WIP1 in vivo rangap1-at4g26450 2 5 unspecified role unspecified role bait bait n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey coiled coil region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range 21 23 physical association physical association Figure 1C A yeast two-hybrid screen was performed to identify proteins that interact with Arabidopsis RanGAP1. WPP-domain Interacting Protein 1 (WIP1, At4g26450) was found to bind full-length RanGAP1 as well as the WPP domain, but not RanGAP1 without the WPP domain rangap1-at5g56210 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 1C WIP2a and WIP3 bind the WPP domain of RanGAP1 but not full-length RanGAP1 The authors noted that "WIP2a and WIP3 bind the WPP domain of RanGAP1 but not full-length RanGAP1". rangap1-at3g13360 2 5 unspecified role unspecified role bait bait n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Figure 1C WIP2a and WIP3 bind the WPP domain of RanGAP1 but not full-length RanGAP1 The authors noted that "WIP2a and WIP3 bind the WPP domain of RanGAP1 but not full-length RanGAP1". rangap2-at4g26450 2 4 unspecified role unspecified role prey prey coiled coil region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range 8 unspecified role unspecified role bait bait physical association physical association Figure 1C RanGAP2 binds WIP1 and WIP2a but not WIP3, and the WIP1 coiled-coil domain is necessary and sufficient for the interaction with RanGAP2. rangap2-at5g56210 2 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Figure 1C RanGAP2 binds WIP1 and WIP2a but not WIP3, and the WIP1 coiled-coil domain is necessary and sufficient for the interaction with RanGAP2. at5g56210 -at4g26450 2 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey coiled coil region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range physical association physical association Figure 1C WIP2a does homodimerize as well as heterodimerize with WIP1, but not with WIP3. at5g56210-at5g56210 2 6 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Figure 1C WIP2a does homodimerize as well as heterodimerize with WIP1, but not with WIP3. at5g43070-at4g26450 2 10 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey coiled coil region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range physical association physical association Figure 1C WPP1 and WPP2 bind all three WIP full-length proteins and the WIP1 coiled-coil domain, whereas WPP3 does not bind WIP family members. at5g4307-at5g56210 2 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Figure 1C WPP1 and WPP2 bind all three WIP full-length proteins and the WIP1 coiled-coil domain, whereas WPP3 does not bind WIP family members. at5g43070-at3g13360 2 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Figure 1C WPP1 and WPP2 bind all three WIP full-length proteins and the WIP1 coiled-coil domain, whereas WPP3 does not bind WIP family members. at1g47200 -at4g26450 2 4 unspecified role unspecified role prey prey coiled coil region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range 9 unspecified role unspecified role bait bait physical association physical association Figure 1C WPP1 and WPP2 bind all three WIP full-length proteins and the WIP1 coiled-coil domain, whereas WPP3 does not bind WIP family members. at1g4720-at5g56210-1 2 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Figure 1C WPP1 and WPP2 bind all three WIP full-length proteins and the WIP1 coiled-coil domain, whereas WPP3 does not bind WIP family members. at1g4720-at3g13360-1 2 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Figure 1C WPP1 and WPP2 bind all three WIP full-length proteins and the WIP1 coiled-coil domain, whereas WPP3 does not bind WIP family members. at3g6313-at4g26450-1 3 5 unspecified role unspecified role neutral component neutral component region c-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region n-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2C To test protein-protein interactions in planta, we employed bimolecular fluorescence complementation (BiFC) [21] and [22]. Figure 2C shows that in planta, all three WIP family members are capable of interacting with RanGAP1 and with WPP1 at the NE. at3g6313-at5g56210-1 3 5 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region n-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2C To test protein-protein interactions in planta, we employed bimolecular fluorescence complementation (BiFC) [21] and [22]. Figure 2C shows that in planta, all three WIP family members are capable of interacting with RanGAP1 and with WPP1 at the NE. at3g6313-at3g13360-2 3 7 unspecified role unspecified role neutral component neutral component region n-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2C To test protein-protein interactions in planta, we employed bimolecular fluorescence complementation (BiFC) [21] and [22]. Figure 2C shows that in planta, all three WIP family members are capable of interacting with RanGAP1 and with WPP1 at the NE. at4g26450-at3g13360 3 7 unspecified role unspecified role neutral component neutral component region n-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2C To test protein-protein interactions in planta, we employed bimolecular fluorescence complementation (BiFC) [21] and [22]. Figure 2C shows that in planta, all three WIP family members are capable of interacting with RanGAP1 and with WPP1 at the NE. at4g26450-at5g56210 3 6 unspecified role unspecified role neutral component neutral component region n-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2C To test protein-protein interactions in planta, we employed bimolecular fluorescence complementation (BiFC) [21] and [22]. Figure 2C shows that in planta, all three WIP family members are capable of interacting with RanGAP1 and with WPP1 at the NE. at4g2645-at4g26450 3 4 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2C To test protein-protein interactions in planta, we employed bimolecular fluorescence complementation (BiFC) [21] and [22]. Figure 2C shows that in planta, all three WIP family members are capable of interacting with RanGAP1 and with WPP1 at the NE.