MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Association of two proteolipids of unknown function with ATP synthase from bovine heart mitochondria. Association of two proteolipids of unknown function with ATP synthase from bovine heart mitochondria. FEBS Lett. (0014-5793) 2007 imex curation Chen R., Runswick MJ., Carroll J., Fearnley IM., Walker JE. 2009-01-08 Only protein-protein interactions bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] chromatography chromatography technology column chromatography chromatography fingerprinting peptide massfingerprinting fingerprinting Chen R., Runswick MJ., Carroll J., Fearnley IM., Walker JE. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation at5g3_bovin ATP synthase F(0) complex subunit C3, mitochondrial ATP5MC3 ATP synthase lipid-binding protein ATP synthase membrane subunit c locus 3 ATP synthase proteolipid P3 ATP5G3 ATPase protein 9 ATPase subunit c protein protein bovin Bos taurus (Bovine) Bovine MFACAKLACTPALIRAGSRVAYRPISASVLSRPETRTGEGCTVFNGTQNGVSQLIQREFQTTAVNRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM mint Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element This protein is the major protein stored in the storage bodies of animals or humans affected with ceroid lipofuscinosis (Batten disease) 5C0D35624290AFDB atpa_bovin ATP synthase subunit alpha, mitochondrial ATP5F1A ATP synthase F1 subunit alpha ATP5A1 ATP5A2 protein protein bovin Bos taurus (Bovine) Bovine MLSVRVAAAVARALPRRAGLVSKNALGSSFIAARNLHASNSRLQKTGTAEVSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLSKIRTDGKISEESDAKLKEIVTNFLAGFEA DIP protein P19483 original sequence version: 148 DIP protein P19483 original sequence version: 91 DIP protein P19483 original sequence version: 90 DIP protein P19483 original sequence version: 106 DIP protein P19483 original sequence version: 124 DIP protein P19483 original sequence version: 132 188E9531B3B815E0 atpmk_bovin ATP synthase membrane subunit K, mitochondrial ATP5MK ATP synthase membrane subunit DAPIT, mitochondrial ATPMD DAPIT Diabetes-associated protein in insulin-sensitive tissues USMG5 Up-regulated during skeletal muscle growth protein 5 protein protein bovin Bos taurus (Bovine) Bovine MAGPEADAQFHFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT mint 1341E9CFE6C0B127 atpb_bovin ATP synthase subunit beta, mitochondrial ATP5F1B ATP synthase F1 subunit beta ATP5B protein protein bovin Bos taurus (Bovine) Bovine MLGLVGRVVAASASGALRGLSPSAPLPQAQLLLRAAPAALQPARDYAAQASPSPKAGATTGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHLGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHS DIP protein P00829 original sequence version: 152 DIP protein P00829 original sequence version: 93 DIP protein P00829 original sequence version: 92 DIP protein P00829 original sequence version: 109 DIP protein P00829 original sequence version: 125 DIP protein P00829 original sequence version: 134 32218D14A5497F18 at5f1_bovin ATP synthase F(0) complex subunit B1, mitochondrial ATP5PB ATP synthase peripheral stalk-membrane subunit b ATP synthase subunit b ATP5F ATP5F1 protein protein bovin Bos taurus (Bovine) Bovine MLSRVVLSAAAAAAPSLKNAALLGPGVLQATRIFHTGQPSLAPVPPLPEHGGKVRFGLIPEEFFQFLYPKTGVTGPYVLGTGLILYLLSKEIYVITPETFSAISTIGFLVYIVKKYGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVVQSISAQQEKETIAKCIADLKLLSKKAQAQPVM DIP protein P13619 original sequence version: 88 5766369D254B3D9A atp5i_bovin ATP synthase subunit e, mitochondrial ATP5ME ATP synthase membrane subunit e ATP5I protein protein bovin Bos taurus (Bovine) Bovine MVPPVQVSPLIKLGRYSALFLGMAYGAKRYNYLKPRAEEERRLAAEEKKKRDEQKRIERELAEAQEDTILK 18E63DB09EF1A132 atp5h_bovin ATP synthase subunit d, mitochondrial ATP5PD ATP synthase peripheral stalk subunit d ATP5H protein protein bovin Bos taurus (Bovine) Bovine MAGRKLALKTIDWVAFGEIIPRNQKAVANSLKSWNETLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPIPEDKYTAQVDAEEKEDVKSCAEFLTQSKTRIQEYEKELEKMRNIIPFDQMTIEDLNEVFPETKLDKKKYPYWPHRPIETL DIP protein P13620 original sequence version: 74 60ED98258E57C7E1 atp5e_bovin ATP synthase subunit epsilon, mitochondrial ATP5F1E ATP synthase F1 subunit epsilon ATP5E protein protein bovin Bos taurus (Bovine) Bovine MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAMKTSGSTIKIVKVKKE DIP protein P05632 original sequence version: 134 DIP protein P05632 original sequence version: 81 DIP protein P05632 original sequence version: 96 DIP protein P05632 original sequence version: 109 DIP protein P05632 original sequence version: 118 mint Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits E0D70FA7C9191CAE atpo_bovin ATP synthase subunit O, mitochondrial ATP5PO ATP synthase peripheral stalk subunit OSCP ATP5O Oligomycin sensitivity conferral protein protein protein bovin Bos taurus (Bovine) Bovine MAALAVSGLSQQVRCFSTSVVRPFAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTVTTASALDEATLTELKTVLKSFLSKGQVLKLEVKIDPSIMGGMIVRIGEKYVDMSAKTKIQKLSRAMREIL DIP protein P13621 original sequence version: 88 C769EC7B778069DA atpk_bovin ATP synthase subunit f, mitochondrial ATP5MF ATP synthase membrane subunit f ATP5J2 protein protein bovin Bos taurus (Bovine) Bovine MASVVPLKEKKLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKGSIAGLSMVLAAYVFLNYCRSYKELKHERLRKYH Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane mint AC5D4BF93F53277B atp68_bovin ATP synthase subunit ATP5MJ, mitochondrial ATP5MJ 6.8 kDa mitochondrial proteolipid 6.8 kDa mitochondrial proteolipid protein ATP5MPL MP68 protein protein bovin Bos taurus (Bovine) Bovine MLQSLIKKVWIPMKPYYTQAYQEIWVGTGLMAYIVYKIRSADKRSKALKASSAAPAHGHH mint 0D8AF6566B0AFD12 atp6_bovin ATP synthase subunit a MT-ATP6 ATP6 ATPASE6 MTATP6 F-ATPase protein 6 protein protein bovin Bos taurus (Bovine) Bovine MNENLFTSFITPVILGLPLVTLIVLFPSLLFPTSNRLVSNRFVTLQQWMLQLVSKQMMSIHNSKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRNKTKASLAHFLPQGTPTPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLALMSISTTTALITFTILILLTILEFAVAMIQAYVFTLLVSLYLHDNT Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane mint ABAD892CB253F126 atp8_bovin ATP synthase protein 8 MT-ATP8 ATP8 ATPASE8 MTATP8 A6L F-ATPase subunit 8 protein protein bovin Bos taurus (Bovine) Bovine MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL 0DED46ADEF5D8BDE atp5l_bovin ATP synthase subunit g, mitochondrial ATP5MG ATP synthase membrane subunit g ATP5L protein protein bovin Bos taurus (Bovine) Bovine MAEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV mint Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane 9E2A9089ADEAC56B atpg_bovin ATP synthase subunit gamma, mitochondrial ATP5F1C ATP synthase F1 subunit gamma ATP5C ATP5C1 F-ATPase gamma subunit protein protein bovin Bos taurus (Bovine) Bovine MFSRAGVAGLSAWTVQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGSLALYEKADIKTPEDKKKHLIIGVSSDRGLCGAIHSSVAKQMKSEAANLAAAGKEVKIIGVGDKIRSILHRTHSDQFLVTFKEVGRRPPTFGDASVIALELLNSGYEFDEGSIIFNRFRSVISYKTEEKPIFSLDTISSAESMSIYDDIDADVLRNYQEYSLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD DIP protein P05631 original sequence version: 140 DIP protein P05631 original sequence version: 105 DIP protein P05631 original sequence version: 118 DIP protein P05631 original sequence version: 124 mint Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits C1F41767CDABAD92 atp5j_bovin ATP synthase-coupling factor 6, mitochondrial ATP5PF ATP synthase peripheral stalk subunit F6 ATP5J protein protein bovin Bos taurus (Bovine) Bovine MILQRLFRLSSAVQSAISVSWRRNIGITAVAFNKELDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFEVVEKPQS DIP protein P02721 original sequence version: 83 E5376A0518C3E1C8 atpd_bovin ATP synthase subunit delta, mitochondrial ATP5F1D ATP synthase F1 subunit delta ATP5D F-ATPase delta subunit protein protein bovin Bos taurus (Bovine) Bovine MLPSALLRRPGLGRLVRQVRLYAEAAAAQAPAAGPGQMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKALE DIP protein P05630 original sequence version: 127 DIP protein P05630 original sequence version: 79 DIP protein P05630 original sequence version: 94 DIP protein P05630 original sequence version: 107 DIP protein P05630 original sequence version: 113 7C47BBAD5A151608 atp5a1-atp5b 1 f 11 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level dapit 4 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level c 2 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level gamma 16 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 6.8KDa 12 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level epsilon 9 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level a 13 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level g 15 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level beta 5 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level delta 18 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level A6L 14 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level d 8 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level e 7 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level alpha 3 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level b 6 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level OSCP 10 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level F6 17 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization F2 F1 FEBS-Letters homomint mint