MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Selective redox regulation of cytokine receptor signaling by extracellular thioredoxin-1. Selective redox regulation of cytokine receptor signaling by extracellular thioredoxin-1. EMBO J. (0261-4189) 2007 imex curation Schwertassek U., Balmer Y., Gutscher M., Weingarten L., Preuss M., Engelhard J., Winkler M., Dick TP. 2009-01-08 Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Schwertassek U., Balmer Y., Gutscher M., Weingarten L., Preuss M., Engelhard J., Winkler M., Dick TP. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation prdx2_human Peroxiredoxin-2 PRDX2 NKEFB TDPX1 Thioredoxin peroxidase 1 Thioredoxin-dependent peroxide reductase 1 Thiol-specific antioxidant protein PRP Natural killer cell-enhancing factor B Thioredoxin-dependent peroxiredoxin 2 protein protein human Homo sapiens Human MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN DIP protein P32119 original sequence version: 173 1AC781D908B32B46 prdx1_human Peroxiredoxin-1 PRDX1 PAGA PAGB TDPX2 Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2 Proliferation-associated gene protein Natural killer cell-enhancing factor A Thioredoxin-dependent peroxiredoxin 1 protein protein human Homo sapiens Human MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK DIP protein Q06830 original sequence version: 144 DIP protein Q06830 original sequence version: 180 8F68E56D75BF5304 thio_human Thioredoxin ATL-derived factor Surface-associated sulphydryl protein TXN TRDX TRX TRX1 protein protein human Homo sapiens Human MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV DIP protein P10599 original sequence version: 174 DIP protein P10599 original sequence version: 133 DIP protein P10599 original sequence version: 181 DIP protein P10599-1 original sequence version: 180 256F4E3C8A187693 txn-prdx2 1 PRX2 2 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level TRX1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified physical association physical association F1D F1E EMBO-Journal homomint mint txn-prdx1 1 PRX1 3 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level TRX1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified physical association physical association F1E EMBO-Journal homomint mint