IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Arabidopsis homologs of components of the SWR1 complex regulate flowering and plant development. Arabidopsis homologs of components of the SWR1 complex regulate flowering and plant development. Development (0950-1991) 2007 imex curation Choi K., Park C., Lee J., Oh M., Noh B., Lee I. Arabidopsis protoplasts were used in this study. ilhalee@snu.ac.kr 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Choi K., Park C., Lee J., Oh M., Noh B., Lee I. Arabidopsis protoplasts were used in this study. ilhalee@snu.ac.kr Accepted 2007-DEC-14 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Development (0950-1991) 2007 orchard Only protein-protein interactions imex curation Arabidopsis homologs of components of the SWR1 complex regulate flowering and plant development. Arabidopsis homologs of components of the SWR1 complex regulate flowering and plant development. Development (0950-1991) 2007 imex curation Choi K., Park C., Lee J., Oh M., Noh B., Lee I. Arabidopsis protoplasts were used in this study. ilhalee@snu.ac.kr 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Choi K., Park C., Lee J., Oh M., Noh B., Lee I. Arabidopsis protoplasts were used in this study. ilhalee@snu.ac.kr Accepted 2007-DEC-14 by ORCHARD. Development (0950-1991) 2007 orchard Only protein-protein interactions imex curation Arabidopsis homologs of components of the SWR1 complex regulate flowering and plant development. Arabidopsis homologs of components of the SWR1 complex regulate flowering and plant development. Development (0950-1991) 2007 imex curation Choi K., Park C., Lee J., Oh M., Noh B., Lee I. Arabidopsis protoplasts were used in this study. ilhalee@snu.ac.kr 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Choi K., Park C., Lee J., Oh M., Noh B., Lee I. Arabidopsis protoplasts were used in this study. ilhalee@snu.ac.kr Accepted 2007-DEC-14 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Development (0950-1991) 2007 orchard Only protein-protein interactions imex curation pie1_arath Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 CHR13 Protein CHROMATIN REMODELING 13 MBK21.19 At3g12810 PIE1 Independent early flowering 1 protein protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASKGGKSKPDIVMASKSGKSKPDNESRAKRQKTLEAPKEPRRPKTHWDHVLEEMAWLSKDFESERKWKLAQAKKVALRASKGMLDQASREERKLKEEEQRLRKVALNISKDMKKFWMKVEKLVLYKHQLVRNEKKKKAMDKQLEFLLGQTERYSTMLAENLVEPYKQGQNTPSKPLLTIESKSDEERAEQIPPEINSSAGLESGSPELDEDYDLKSEDETEDDEDTIEEDEKHFTKRERQEELEALQNEVDLPVEELLRRYTSGRVSRETSPVKDENEDNLTSVSRVTSPVKDENQDNLASVGQDHGEDKNNLAASEETEGNPSVRRSNDSYGHLAISETHSHDLEPGMTTASVKSRKEDHTYDFNDEQEDVDFVLANGEEKDDEATLAVEEELAKADNEDHVEEIALLQKESEMPIEVLLARYKEDFGGKDISEDESESSFAVSEDSIVDSDENRQQADLDDDNVDLTECKLDPEPCSENVEGTFHEVAEDNDKDSSDKIADAAAAARSAQPTGFTYSTTKVRTKLPFLLKHSLREYQHIGLDWLVTMYEKKLNGILADEMGLGKTIMTIALLAHLACDKGIWGPHLIVVPTSVMLNWETEFLKWCPAFKILTYFGSAKERKLKRQGWMKLNSFHVCITTYRLVIQDSKMFKRKKWKYLILDEAHLIKNWKSQRWQTLLNFNSKRRILLTGTPLQNDLMELWSLMHFLMPHVFQSHQEFKDWFCNPIAGMVEGQEKINKEVIDRLHNVLRPFLLRRLKRDVEKQLPSKHEHVIFCRLSKRQRNLYEDFIASTETQATLTSGSFFGMISIIMQLRKVCNHPDLFEGRPIVSSFDMAGIDVQLSSTICSLLLESPFSKVDLEALGFLFTHLDFSMTSWEGDEIKAISTPSELIKQRVNLKDDLEAIPLSPKNRKNLQGTNIFEEIRKAVFEERIQESKDRAAAIAWWNSLRCQRKPTYSTSLRTLLTIKGPLDDLKANCSSYMYSSILADIVLSPIERFQKMIELVEAFTFAIPAARVPSPTCWCSKSDSPVFLSPSYKEKVTDLLSPLLSPIRPAIVRRQVYFPDRRLIQFDCGKLQELAMLLRKLKFGGHRALIFTQMTKMLDVLEAFINLYGYTYMRLDGSTPPEERQTLMQRFNTNPKIFLFILSTRSGGVGINLVGADTVIFYDSDWNPAMDQQAQDRCHRIGQTREVHIYRLISESTIEENILKKANQKRVLDNLVIQNGEYNTEFFKKLDPMELFSGHKALTTKDEKETSKHCGADIPLSNADVEAALKQAEDEADYMALKRVEQEEAVDNQEFTEEPVERPEDDELVNEDDIKADEPADQGLVAAGPAKEEMSLLHSDIRDERAVITTSSQEDDTDVLDDVKQMAAAAADAGQAISSFENQLRPIDRYAIRFLELWDPIIVEAAMENEAGFEEKEWELDHIEKYKEEMEAEIDDGEEPLVYEKWDADFATEAYRQQVEVLAQHQLMEDLENEAREREAAEVAEMVLTQNESAHVLKPKKKKKAKKAKYKSLKKGSLAAESKHVKSVVKIEDSTDDDNEEFGYVSSSDSDMVTPLSRMHMKGKKRDLIVDTDEEKTSKKKAKKHKKSLPNSDIKYKQTSALLDELEPSKPSDSMVVDNELKLTNRGKTVGKKFITSMPIKRVLMIKPEKLKKGNLWSRDCVPSPDSWLPQEDAILCAMVHEYGPNWNFVSGTLYGMTAGGAYRGRYRHPAYCCERYRELIQRHILSASDSAVNEKNLNTGSGKALLKVTEENIRTLLNVAAEQPDTEMLLQKHFSCLLSSIWRTSTRTGNDQMLSLNSPIFNRQFMGSVNHTQDLARKPWQGMKVTSLSRKLLESALQDSGPSQPDNTISRSRLQETQPINKLGLELTLEFPRGNDDSLNQFPPMISLSIDGSDSLNYVNEPPGEDVLKGSRVAAENRYRNAANACIEDSFGWASNTFPANDLKSRTGTKAQSLGKHKLSASDSAKSTKSKHRKLLAEQLEGAWVRPNDPNLKFDFTPGDREEEEEQEVDEKANSAEIEMISCSQWYDPFFTSGLDDCSLASDISEIE ED38EC3C67D7F776 swc2_arath SWR1 complex subunit 2 SWC2 F13K3.14 At2g36740 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEIDEEEPMVFLDRTTRATRGKRMTKLLDDEVEEDEQFWNQEALKEEEHDDEYEAEREVADEFDSDFNDDEPEPDAVAVNEKELRDLPKKRLIYPGKTASKKKKKKTKVVSQLEYIPGDEKPGEELGNKEQEEKEENEAQEDMEGEKVIRKSTRTSVVVRQAERDALRAAIQATTKPIQRKKVGEEKRMTQEEMLLEAAQTEIMNLRNLERVLAREEEVKKKAIVHKAVYKGPQIRYHSKDGCNYLEFCNGASFNSELSTKSVPYPEKAVCVITGLPAKYRDPKTGLPYATRDAFKAIRERFMDEHDGLRKKMEMGDLFDTLVAKGFATKQKRTKIPKSNKSFSLRSSARFLSSESEEESEEDSD 15A76C12BBDDBA53 h2av1_arath Histone H2A variant 1 H2AV T14E10.130 At3g54560 H2A.F/Z 1 HTA11 H2AvAt protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGKGGKGLVAAKTMAANKDKDKDKKKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE 6BD03677F6BBEA1C swc6_arath SWR1 complex subunit 6 SWC6 Protein SERRATED LEAVES AND EARLY FLOWERING SEF MJG14.20 MJG14.4 At5g37055 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEEMSNRRVSNRTRKVATKMAAALTSNDNRTQAAIARLEALENDNGAIEVIDLNDDEEASLDEDDDLGYLQKKQHKGSKRKTRQAKALEARKAPKSFLELLQEANLESLPSHVPTYLKAAVGPPSSSSRRYFCSVCGYIAGYNCCLCGMRFCSIRCQNIHKDTRCQKFVA 250F42A946949E41 h2av3_arath Probable histone H2A variant 3 HTA9 H2A.F/Z 3 F14G24.1 At1g52740 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSGKGAKGLIMGKPSGSDKDKDKKKPITRSSRAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSAKE BE63E2B00DC3955A h2av2_arath Probable histone H2A variant 2 HTA8 H2A.F/Z 2 F13I13.4 At2g38810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGKGGKGLLAAKTTAAAANKDSVKKKSISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD F4F09FABFBD67A79 arp6_arath Actin-related protein 6 ESD1 SUF3 Protein EARLY IN SHORT DAYS 1 Protein SUPPRESSOR OF FRIGIDA 3 T4P3.8 ARP6 At3g33520 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNIVVLDNGGGLIKAGQGGERDPTTVIPNCLYKPLSSKKFIHPSPLTTLSDEIDLTSAAVRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFEDFGFSSLYIAHPQSLVHLYEASRQPDSILSKTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKRIDLGGKAFTNYLKELVSYRSINVMDETFLVDDAKEKLCFVSLDLLRDLRLARNGNTLIKSTYVLPDGVTHTKGYVKDPQAAKRFLSLSEKESVVVMDKVGERKKADMNKNEIDLTNERFLVPETLFQPADLGMNQAGLAECIVRAINSCHSYLQPVLYQSIILTGGSTLFPQLKERLEGELRPLVPDHFDVKITTQEDPILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 9854EDAB8630030F swc6-suf3 2 7 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 5 By contrast, when AtSWC6:RFP proteins were expressed with SUF3:GFP, most of the AtSWC6:RFP proteins moved to where SUF3:GFP proteins were localized, such that the fluorescence overlapped The authors conclude that "Our data thus indicate that AtSWC6:RFP relocates to the nuclear periphery where SUF3:GFP is localized, and strongly suggests that the two proteins interact". swc6-suf3-1 3 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 6 The results showed that AtSWC6 interacts with SUF3 and AtSWC2, and revealed homodimerization of AtSWC6 swc6-swc6 3 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 6 The results showed that AtSWC6 interacts with SUF3 and AtSWC2, and revealed homodimerization of AtSWC6 swc6-swc2 3 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 6 The results showed that AtSWC6 interacts with SUF3 and AtSWC2, and revealed homodimerization of AtSWC6 suf3-swc6 3 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 6 swc2-swc6 3 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 6 hta8-swc2 3 9 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 6 AtSWC2 also interacted with all three H2AZs hta9--swc2 3 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 6 AtSWC2 also interacted with all three H2AZs hta11-swc2-1 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 6 AtSWC2 also interacted with all three H2AZs swc2-hta11 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 6 AtSWC2 also interacted with all three H2AZs swc2-hta8 3 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 6 AtSWC2 also interacted with all three H2AZs swc2-hta9 3 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 6 AtSWC2 also interacted with all three H2AZs pie-suf3-2 3 4 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey physical association physical association 6 PIE1-C interacted with both SUF3 and AtSWC6 pie-swc6 3 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6 PIE1-C interacted with both SUF3 and AtSWC6 pie-hta8 3 9 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6 and PIE1-N interacted with the three H2AZs (HTA8, HTA9, HTA11) but not with the other proteins tested pie-hta9 3 8 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6 and PIE1-N interacted with the three H2AZs (HTA8, HTA9, HTA11) but not with the other proteins tested pie-hta11 3 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6 and PIE1-N interacted with the three H2AZs (HTA8, HTA9, HTA11) but not with the other proteins tested swc6-pie 3 4 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association 6 PIE1-C interacted with both SUF3 and AtSWC6 suf3-pie 3 4 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait physical association physical association 6 PIE1-C interacted with both SUF3 and AtSWC6 hta8-pie 3 4 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait physical association physical association 6 and PIE1-N interacted with the three H2AZs (HTA8, HTA9, HTA11) but not with the other proteins tested hta9-pie1 3 8 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6 and PIE1-N interacted with the three H2AZs (HTA8, HTA9, HTA11) but not with the other proteins tested hta11-pie1 3 4 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association 6 and PIE1-N interacted with the three H2AZs (HTA8, HTA9, HTA11) but not with the other proteins tested swc6-suf3-2 1 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 Protein gel blots showing interaction between AtSWC6 and SUF3. swc6-swc6-1 1 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 swc6-swc2-1 1 7 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 The interactions of AtSWC6-SUF3, AtSWC6- AtSWC2, AtSWC2-HTA11, PIE1-SUF3, and PIE1-AtSWC6 were confirmed by the in planta coimmunoprecipitation assay. hta11-swc2 1 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 The interactions of AtSWC6-SUF3, AtSWC6- AtSWC2, AtSWC2-HTA11, PIE1-SUF3, and PIE1-AtSWC6 were confirmed by the in planta coimmunoprecipitation assay. suf3-pie-1 1 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 The interactions of AtSWC6-SUF3, AtSWC6- AtSWC2, AtSWC2-HTA11, PIE1-SUF3, and PIE1-AtSWC6 were confirmed by the in planta coimmunoprecipitation assay. swc6-pie-1 1 4 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 The interactions of AtSWC6-SUF3, AtSWC6- AtSWC2, AtSWC2-HTA11, PIE1-SUF3, and PIE1-AtSWC6 were confirmed by the in planta coimmunoprecipitation assay.