MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it FKBP22 is part of chaperone/folding catalyst complexes in the endoplasmic reticulum of Neurospora crassa. FKBP22 is part of chaperone/folding catalyst complexes in the endoplasmic reticulum of Neurospora crassa. FEBS Lett. (0014-5793) 2007 imex curation Tremmel D., Duarte M., Videira A., Tropschug M. 2009-01-08 Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) crosslink cross-linking study crosslink predetermined predetermined participant predetermined Tremmel D., Duarte M., Videira A., Tropschug M. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation FKBP22 is part of chaperone/folding catalyst complexes in the endoplasmic reticulum of Neurospora crassa. FKBP22 is part of chaperone/folding catalyst complexes in the endoplasmic reticulum of Neurospora crassa. FEBS Lett. (0014-5793) 2007 imex curation Tremmel D., Duarte M., Videira A., Tropschug M. 2009-01-08 Only protein-protein interactions neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Tremmel D., Duarte M., Videira A., Tropschug M. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation q7s399_neucr Protein disulfide-isomerase NCU09223 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MHAPTKFALGLLAAAAVATASDVIQLKKDTFDDFVKTNDIVLAEFFAPWCGHCKALAPEYEEAATTLKEKNIKLAKIDCTEESELCQQHGVEGYPTLKVFRGLEVVSPYKGQRKAAAITSYMIKQSLPSVSELNKDNIEEFKKADKVVIVAYLDAADKASNETFSKVADKLRDEYPFGASSDAALAEAEGVTAPAIVLYKDFDEGKAVFTEKFDPEAIEKFAKTASTPLIGEVGPDTYAGYMSAGIPLAYIFAETPEERKELSEALKSIAEAQRGVINFATIDAKAFGAHAGNLNLKADKFPAFAIQDTTKNLKFPFDQEKEITADSIKKFVDDFVAGKVEPTIKSEPIPETQEGPVTVVVAKSYDDIVLDDTKDVLIEFYAPWCGHCKALAPKYDELATLYANSDFKDKVVIAKVDATQNDVPDEIQGFPTIKLYAAGAKDKPVEYSGPRTVEDLIKFISENGKYKASPPAEAEESVAASAESGSSTETGTVEEPAKETSHDEL mint C9AE52FCFC379B3A hsp70_neucr Heat shock 70 kDa protein hsps-1 B18E6.040 NCU09602 HSP70 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MAPAVGIDLGTTYSCVGVFREDRCEIIANDQGNRTTPSFVAFTDTERLVGDAAKNQVAMNPANTVFDAKRLIGRKFSDPEVQADMKHFPFKVIDRGGKPVIQVEFKGETKVFTPEEISAMILQKMKETAEAYLGGTVNNAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDKKVEGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVQEFKRKHKKDLSTNARALRRLRTACERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCQDLFRSTLQPVDRVLTDAKIDKSQVHEIVLVGGSTRIPRIQKLISDYFNGKEPNKSINPDEAVAYGAAVQAAILSGDTSSKSTSEILLLDVAPLSLGIETAGGMMTKLIPRNTTIPTKKSEVFSTFSDNQPGVLIQVYEGERQRTKDNNLLGKFELTGIPPAPRGVPQIEVTFDVDANGIMNVSALEKGTGKTNQITITNDKGRLSKEEIERMLAEAEKFKEEDEAEAKRVAAKNGLESYAYSLRNTLSDSKVDEKLDAADKEKLKSEIDKIVAWLDENQQATREEYEERQKELEAIANPIMMKFYGAGGAPGGMPGAAPGGFPGGAPGSNDNEGPTVEEVD mint AB0C8DC5DBE4714A bip_neucr Endoplasmic reticulum chaperone BiP grp78 NCU03982 Immunoglobulin heavy chain-binding protein homolog protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MEHRTRSWALGLSILGFFALLFSAGFVQQAHANDTEAMGTVIGIDLGTTYSCVGVMQKGKVEILVNDQGNRITPSYVAFTDEERLVGDAAKNQAAANPHRTIFDIKRLIGRKFSDKDVQNDIKHFPYKVVSKDDKPVVKVEVKGEEKTFTPEEISAMILGKMKETAEGYLGKKVTHAVVTVPAYFNDNQRQATKDAGMIAGLNVLRIVNEPTAAAIAYGLDKTGEERQIIVYDLGGGTFDVSLLSIEQGVFEVLSTAGDTHLGGEDFDQRIINHFAKLFNKKHGVDVTKDAKAMGKLKREAEKAKRTLSSQMSTRIEIEAFYDGKDFSETLTRAKFEELNNDLFKKTLKPVEQVLKDAKVSKSEIDDIVLVGGSTRIPKVQALIEEFFNGKKASKGINPDEAVAFGAAVQAGVLSGEEGTEDIVLMDVNPLTLGIETTGGVMTKLIPRNTPIPTRKSQIFSTAADNQPVVLIQVYEGERSMTKDNNLLGKFELTGIPPAPRGVPQIEVSFELDANGILKVSAHDKGTGKAESITITNDKGRLTQEEIDRMVAEAEKYAEEDKATRERIEARNGLENYAFSLKNQVNDEDGLGGKIDEEDKETILDAVKEAQDWLEENAATASAEDFDEQKEKLSNVAYPITSKLYSQGGAGDDEPAGHDEL Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER mint 90963337AF327DEA ppib_neucr Peptidyl-prolyl cis-trans isomerase B cpr2 Rotamase B 18F11.170 NCU01200 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MFSLRRLLLAATLFLGAMLLFAQSAEAAKGPKITHKVYFDIEQGDKPLGRIVMGLYGKTVPKTAENFRALATGEKGFGYEGSTFHRVIKQFMIQGGDFTKGDGTGGKSIYGDKFPDENFKLKHSKKGLLSMANAGKDTNGSQFFITTVITSWLDGKHVVFGEVLEGYDVVEKIENTKTGPRDAPAEPIKIAKSGELEVPPEGLEGQSEWASPAYANEDEKPAAPVPVTDAKPPAHDSIPAATADDDDTGAPLFAKVLFFGVLVLGLVLYIRLRRAPKGTYGKGME mint PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides C8C6DD66836DBB6F fkbp2_neucr FK506-binding protein 2 fkr-5 FK506-resistance protein 5 NcFKBP22 Peptidyl-prolyl cis-trans isomerase fkr-5 NCU02455 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MKSIFLSLSLLASATVGVLAAEELGIDVTVPVECDRKTRKGDKINVHYRGTLQSNGQQFDASYDRGTPFSFKLGGGQVIKGWDEGLVDMCIGEKRTLTVPPSYGYGQRSIGPIPAGSTLIFETELIGIDGVPKPESIVYKQAAEKAEEAASAVEEKVAEATDKAGGKIADATKKVEEKAEEASANVVEKVASVVSGAAEAVKTVVADTDDVQEHNEL mint PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides 72313067521BCDAF erp38_neucr Protein disulfide-isomerase erp38 erp38 17E5.50 NCU03739 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MVLLKSLVVASLAAAVAAKSAVLDLIPSNFDDVVLKSGKPTLVEFFAPWCGHCKNLAPVYEELATALEYAKDKVQIAKVDADAERALGKRFGVQGFPTLKFFDGKSEQPVDYKGGRDLDSLSNFIAEKTGVKARKKGSAPSLVNILNDATIKGAIGGDKNVLVAFTAPWCGHCKNLAPTWEKLAATFASDPEITIAKVDADAPTGKKSAAEYGVSGFPTIKFFPKGSTTPEDYNGGRSEADLVKFLNEKAGTHRTPGGGLDTVAGTIAALDEIVAKYTGGASLAEVAEEAKEAVKSLKNSAELKYADYYLRVLDKLSKSEGYATKEFARLEGILKKGGLAPAKVDELTVKVNVLRKFVEKAAEEAKEEL mint 4554092E43A8F3E6 fkbp22-cpr_2 1 PDI 3 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Grp170 4 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Bip 5 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Glucosidase II alpha subunit 5 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level fkbp22 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38 8 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level cyp23 6 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2 FEBS-Letters mint fkbp22-cpr_2-1 1 fkbp22 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Bip 5 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level cyp23 6 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38 8 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3B FEBS-Letters mint grp78-cpr_2 1 fkbp22 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Bip 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level cyp23 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level PDI 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3C FEBS-Letters mint q7s399-cpr_2 1 fkbp22 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Bip 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level PDI 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level cyp23 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3C FEBS-Letters mint erp38-cpr_2 1 PDI 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level cyp23 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Bip 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level fkbp22 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3C FEBS-Letters mint fkbp22-cpr_2-2 1 erp38 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level cyp23 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Bip 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level fkbp22 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level PDI 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3C FEBS-Letters mint cpr_2-erp38 1 cyp23 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Bip 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level PDI 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3C FEBS-Letters mint fkbp22-grp78 2 fkbp22 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Bip 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization F4 FEBS-Letters mint fkbp22-grp78-1 2 PDI 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Bip 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level fkbp22 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization F4B FEBS-Letters Microsomes were treated with DSP. mint