MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Mob as tumor suppressor is activated by Hippo kinase for growth inhibition in Drosophila. Mob as tumor suppressor is activated by Hippo kinase for growth inhibition in Drosophila. EMBO J. (0261-4189) 2007 imex curation Wei X., Shimizu T., Lai ZC. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wei X., Shimizu T., Lai ZC. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Mob as tumor suppressor is activated by Hippo kinase for growth inhibition in Drosophila. Mob as tumor suppressor is activated by Hippo kinase for growth inhibition in Drosophila. EMBO J. (0261-4189) 2007 imex curation Wei X., Shimizu T., Lai ZC. 2009-01-08 Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Wei X., Shimizu T., Lai ZC. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Mob as tumor suppressor is activated by Hippo kinase for growth inhibition in Drosophila. Mob as tumor suppressor is activated by Hippo kinase for growth inhibition in Drosophila. EMBO J. (0261-4189) 2007 imex curation Wei X., Shimizu T., Lai ZC. 2009-01-08 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wei X., Shimizu T., Lai ZC. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Mob as tumor suppressor is activated by Hippo kinase for growth inhibition in Drosophila. Mob as tumor suppressor is activated by Hippo kinase for growth inhibition in Drosophila. EMBO J. (0261-4189) 2007 imex curation Wei X., Shimizu T., Lai ZC. 2009-01-08 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wei X., Shimizu T., Lai ZC. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation hgfl_human Hepatocyte growth factor-like protein D3F15S2 DNF15S2 HGFL Macrophage stimulatory protein Macrophage-stimulating protein MST1 protein protein human Homo sapiens Human MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRGTMATTVGGLPCQAWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYCRNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGKGEGYRGTANTTTAGVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTLRPGMRAAFCYQIRRCTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEKCGKRVDRLDQRRSKLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGTKCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGDYGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVFVDWIHKVMRLG DIP protein P26927 original sequence version: 144 2E4B3C7D4AA9B566 mob1b_human MOB kinase activator 1B MOB1B MOB4A MOBKL1A Mob1 homolog 1A Mob1B Mps one binder kinase activator-like 1A protein protein human Homo sapiens Human MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR 29EBA287B0CDAF90 mob1_drome MOB kinase activator-like 1 Mob as tumor suppressor protein 1 mats Mps one binder kinase activator-like 1 CG13852 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDFLFGSRSSKTFKPKKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGTITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPLQELIDKLTAKDERQI 6B16E04A08B59208 hippo_drome Serine/threonine-protein kinase hippo hpo dMST Drosophila homolog of MST1 and MST2 STE20-like kinase MST CG11228 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSEPEVTSVVDMKSPNISSSCSFFKLKKLSEESLLQPPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIKEISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAKHRSILKPMLEETCAIREQQRANRSFGGVLAASQAKSLATQENGMQQHITDNAFMEDPGTLVPEKFGEYQQSSASDATMIAHAEQGVDEGTLGPGGLRNLSKAAAPAAASSAASPLDMPAVDSGTMVELESNLGTMVINSDSDDSTTAKNNDDQKPRNRYRPQFLEHFDRKNAGDGRGDEKPIATEYSPAAAEQQQQQQQQQQQQQQDEQHLASGANDLNNWEHNMEMQFQQISAINQYGLQQHQQQQQVLMAYPLMNEQLIALNNQPNLLLSNAAPMGQQGIPAAAPAQPPPAYQNQHMHTQSHAYVEGEFEFLKFLTFDDLNQRLCNIDHEMELEIEQLNKKYNAKRQPIVDAMNAKRKRQQNINNNLIKI DIP protein Q8T0S6 original sequence version: 100 B3DDDFAF5F4E4EB3 stk3_rat Serine/threonine-protein kinase 3 Stk3 Mst2 STE20-like kinase MST2 Mammalian STE20-like protein kinase 2 protein protein rat Rattus norvegicus (Rat) Rat MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDVQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFIKNAKPVSILRELITEGMEIKAKRHEEQQRELEDEEENSDEDELDSHTMVKTSSEGVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCDQSMREPCPMSNNVFPDNWRVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELHQRYSAKRQPILDAMDAKKRRQQNF Stress-activated, pro-apoptotic kinase which, following caspase-cleavage, enters the nucleus and induces chromatin condensation followed by internucleosomal DNA fragmentation. Phosphorylates and activates LATS1 and LATS2 (By similarity). Phosphorylates NKX2-1 mint 90FA6B020E7FFD62 q24590_drome wts CG12072 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHPAGEKRGGRPNDKYTAEALESIKQDLTRFEVQNNHRNNQNYTPLRYTATNGRNDALTPDYHHAKQPMEPPPSASPAPDVVIPPPPAIVGQPGAGSISVSGVGVGVVGVANGRVPKMMTALMPNKLIRKPSIERDTASSHYLRCSPALDSGAGSSRSDSPHSHHTHQPSSRTVGNPGGNGGFSPSPSGFSEVAPPAPPPRNPTASSAATPPPPVPPTSQAYVKRRSPALNNRPPAIAPPTQRGNSPVITQNGLKNPQQQLTQQLKSLNLYPGGGSGAVVEPPPPYLIQGGAGGAAPPPPPPSYTASMQSRQSPTQSQQSDYRKSPSSGIYSATSAGSPSPITVSLPPAPLAKPQPRVYQARSQQPIIMQSVKSTQVQKPVLQTAVAPQSPSSASASNSPVHVLAAPPSYPQKSAAVVQQQQQAAAAAHQQQHQHQQSKPATPTTPPLVGLNSKPNCLEPPSYAKSMQAKAATVVQQQQQQQQQQQVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERERDQQKLANGNPGRQMLPPPPYQSNNNNNSEIKPPSCNNNNIQISNSNLATTPPIPPAKYNNNSSNTGANSSGGSNGSTGTTASSSTSCKKIKHASPIPERKKISKEKEEERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGKSVDEVKSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGDDVDQNDRTFHGFFEFTFRRFFDDKQPPDMTDDQAPVYV mint EB35192A10470805 mats-hpo 1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3D EMBO-Journal homomint mint mats-hpo-1 1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3D EMBO-Journal homomint mint mst1-mob1b 3 mats 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell MST1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3E EMBO-Journal homomint mint mats-stk3 2 MST2 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation F3C EMBO-Journal homomint mint wts-mats 4 wts 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F5A EMBO-Journal homomint mint wts-hpo 4 wts 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F5C EMBO-Journal homomint mint