MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Histone H2AX and Fanconi anemia FANCD2 function in the same pathway to maintain chromosome stability. Histone H2AX and Fanconi anemia FANCD2 function in the same pathway to maintain chromosome stability. EMBO J. (0261-4189) 2007 imex curation Bogliolo M., Lyakhovich A., Callén E., Castellà M., Cappelli E., Ramírez MJ., Creus A., Marcos R., Kalb R., Neveling K., Schindler D., Surrallés J. 2009-01-08 Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bogliolo M., Lyakhovich A., Callén E., Castellà M., Cappelli E., Ramírez MJ., Creus A., Marcos R., Kalb R., Neveling K., Schindler D., Surrallés J. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation h2ax_mouse Histone H2AX H2ax H2a.x H2afx Hist5-2ax Histone H2A.X protein protein mouse Mus musculus Mouse MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGPKAPAVGKKASQASQEY A3683760C13CC2B9 facd2_mouse Fanconi anemia group D2 protein homolog Fancd2 protein protein mouse Mus musculus Mouse MISKRRRLDSEDKENLTEDASKTMPLSKLAKKSHNSHEVEENGSVFVKLLKASGLTLKTGENQNQLGVDQVIFQRKLFQALRKHPAYPKVIEEFVNGLESYTEDSESLRNCLLSCERLQDEEASMGTFYSKSLIKLLLGIDILQPAIIKMLFEKVPQFLFESENRDGINMARLIINQLKWLDRIVDGKDLTAQMMQLISVAPVNLQHDFITSLPEILGDSQHANVGKELGELLVQNTSLTVPILDVFSSLRLDPNFLSKIRQLVMGKLSSVRLEDFPVIVKFLLHSVTDTTSLEVIAELRENLNVQQFILPSRIQASQSKLKSKGLASSSGNQENSDKDCIVLVFDVIKSAIRYEKTISEAWFKAIERIESAAEHKALDVVMLLIIYSTSTQTKKGVEKLLRNKIQSDCIQEQLLDSAFSTHYLVLKDICPSILLLAQTLFHSQDQRIILFGSLLYKYAFKFFDTYCQQEVVGALVTHVCSGTEAEVDTALDVLLELIVLNASAMRLNAAFVKGILDYLENMSPQQIRKIFCILSTLAFSQQPGTSNHIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAEDRSVPSNSSQRSANVSSEQRTQVTSLLQLVHSCTEHSPWASSLYYDEFANLIQERKLAPKTLEWVGQTIFNDFQDAFVVDFCAAPEGDFPFPVKALYGLEEYSTQDGIVINLLPLFYQECAKDASRATSQESSQRSMSSLCLASHFRLLRLCVARQHDGNLDEIDGLLDCPLFLPDLEPGEKLESMSAKDRSLMCSLTFLTFNWFREVVNAFCQQTSPEMKGKVLSRLKDLVELQGILEKYLAVIPDYVPPFASVDLDTLDMMPRSSSAVAAKNRNKGKTGGKKQKADSNKASCSDTLLTEDTSECDMAPSGRSHVDKESTGKEGKTFVSLQNYRAFFRELDIEVFSILHSGLVTKFILDTEMHTEATEVVQLGPAELLFLLEDLSQKLENMLTAPFAKRICCFKNKGRQNIGFSHLHQRSVQDIVHCVVQLLTPMCNHLENIHNFFQCLGAEHLSADDKARATAQEQHTMACCYQKLLQVLHALFAWKGFTHQSKHRLLHSALEVLSNRLKQMEQDQPLEELVSQSFSYLQNFHHSVPSFQCGLYLLRLLMALLEKSAVPNQKKEKLASLAKQLLCRAWPHGEKEKNPTFNDHLHDVLYIYLEHTDNVLKAIEEITGVGVPELVSAPKDAASSTFPTLTRHTFVIFFRVMMAELEKTVKGLQAGTAADSQQVHEEKLLYWNMAVRDFSILLNLMKVFDSYPVLHVCLKYGRRFVEAFLKQCMPLLDFSFRKHREDVLSLLQTLQLNTRLLHHLCGHSKIRQDTRLTKHVPLLKKSLELLVCRVKAMLVLNNCREAFWLGTLKNRDLQGEEIISQDPSSSESNAEDSEDGVTSHVSRNRATEDGEDEASDEQKDQDSDESDDSSS mint Required for maintenance of chromosomal stability. Promotes accurate and efficient pairing of homologs during meiosis. Involved in the repair of DNA double-strand breaks, both by homologous recombination and single-strand annealing. May participate in S phase and G2 phase checkpoint activation upon DNA damage. Promotes BRCA2/FANCD1 loading onto damaged chromatin. May also be involved in B-cell immunoglobulin isotype switching B1B9AE5B580AC2E9 h2afx-fancd2 1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:44 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Ser139;136Ala range MINT-4507656: original sequence: 136-136 : GPKAPAVGKKASQASQE range MINT-4507657: original sequence: 139-139 : APAVGKKASQASQE 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F5B F5A Interaction occurs also inBRCA1 cells. homomint mint fancd2-h2afx-1 1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:49 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Ser136;139Ala range MINT-4507663: original sequence: 139-139 : APAVGKKASQASQE range MINT-4507664: original sequence: 136-136 : GPKAPAVGKKASQASQE 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F5B F5A Interaction occurs also inBRCA1 cells. homomint mint