IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A mechanism for cell-cycle regulation of MAP kinase signaling in a yeast differentiation pathway. A mechanism for cell-cycle regulation of MAP kinase signaling in a yeast differentiation pathway. Cell (0092-8674) 2007 imex curation Strickfaden SC., Winters MJ., Ben-Ari G., Lamson RE., Tyers M., Pryciak PM. peter.pryciak@umassmed.edu 26-APR-2007: Contacted by JYOTI. Only protein-protein interactions 2 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Strickfaden SC., Winters MJ., Ben-Ari G., Lamson RE., Tyers M., Pryciak PM. peter.pryciak@umassmed.edu Accepted 2007-MAY-10 by JYOTI. 26-APR-2007: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 2 imex curation A mechanism for cell-cycle regulation of MAP kinase signaling in a yeast differentiation pathway. A mechanism for cell-cycle regulation of MAP kinase signaling in a yeast differentiation pathway. Cell (0092-8674) 2007 imex curation Strickfaden SC., Winters MJ., Ben-Ari G., Lamson RE., Tyers M., Pryciak PM. peter.pryciak@umassmed.edu 26-APR-2007: Contacted by JYOTI. Only protein-protein interactions 2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Strickfaden SC., Winters MJ., Ben-Ari G., Lamson RE., Tyers M., Pryciak PM. peter.pryciak@umassmed.edu Accepted 2007-MAY-10 by JYOTI. 26-APR-2007: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 2 imex curation ste5_yeast Protein STE5 STE5 NUL3 YDR103W YD8557.12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MMETPTDNIVSPFHNFGSSTQYSGTLSRTPNQIIELEKPSTLSPLSRGKKWTEKLARFQRSSAKKKRFSPSPISSSTFSFSPKSRVTSSNSSGNEDGNLMNTPSTVSTDYLPQHPHRTSSLPRPNSNLFHASNSNLSRANEPPRAENLSDNIPPKVAPFGYPIQRTSIKKSFLNASCTLCDEPISNRRKGEKIIELACGHLSHQECLIISFGTTSKADVRALFPFCTKCKKDTNKAVQCIPENDELKDILISDFLIHKIPDSELSITPQSRFPPYSPLLPPFGLSYTPVERQTIYSQAPSLNPNLILAAPPKERNQIPQKKSNYTFLHSPLGHRRIPSGANSILADTSVALSANDSISAVSNSVRAKDDETKTTLPLLRSYFIQILLNNFQEELQDWRIDGDYGLLRLVDKLMISKDGQRYIQCWCFLFEDAFVIAEVDNDVDVLEIRLKNLEVFTPIANLRMTTLEASVLKCTLNKQHCADLSDLYIVQNINSDESTTVQKWISGILNQDFVFNEDNITSTLPILPIIKNFSKDVGNGRHETSTFLGLINPNKVVEVGNVHDNDTVIIRRGFTLNSGECSRQSTVDSIQSVLTTISSILSLKREKPDNLAIILQIDFTKLKEEDSLIVVYNSLKALTIKFARLQFCFVDRNNYVLDYGSVLHKIDSLDSISNLKSKSSSTQFSPIWLKNTLYPENIHEHLGIVAVSNSNMEAKKSILFQDYRCFTSFGRRRPNELKIKVGYLNVDYSDKIDELVEASSWTFVLETLCYSFGLSFDEHDDDDEEDNDDSTDNELDNSSGSLSDAESTTTIHIDSPFDNENATANMVNDRNLLTEGEHSNIENLETVASSVQPALIPNIRFSLHSEEEGTNENENENDMPVLLLSDMDKGIDGITRRSSFSSLIESGNNNCPLHMDYI 0435BDA0196B2D6F 0435BDA0196B2D6F cg12_yeast G1/S-specific cyclin CLN2 CLN2 YPL256C protein protein yeast Saccharomyces cerevisiae Baker's yeast MASAEPRPRMGLVINAKPDYYPIELSNAELLSHFEMLQEYHQEISTNVIAQSCKFKPNPKLIDQQPEMNPVETRSNIITFLFELSVVTRVTNGIFFHSVRLYDRYCSKRIVLRDQAKLVVATCLWLAAKTWGGCNHIINNVVIPTGGRFYGPNPRARIPRLSELVHYCGDGQVFDESMFLQMERHILDTLNWNIYEPMINDYVLNVDENCLMQYELYENQVTYDKQCSEKRQSQLSQDSDATVDERPYQNEEEEEEDLKLKIKLINLKKFLIDVSAWQYDLLRYELFEVSHGIFSIINQFTNQDHGPFLMTPMTSESKNGEILSTLMNGIVSIPNSLMEVYKTVNGVLPFINQVKEYHLDLQRKLQIASNLNISRKLTISTPSCSFENSNSTSIPSPASSSQSHTPMRNMSSLSDNSVFSRNMEQSSPITPSMYQFGQQQSNSICGSTVSVNSLVNTNNKQRIYEQITGPNSNNATNDYIDLLNLNESNKENQNPATAHYLNGGPPKTSFINHGMFPSPTGTINSGKSSSASSLISFGMGNTQVI D6426B94E040E960 D6426B94E040E960 cdk1_yeast Cyclin-dependent kinase 1 CDC28 CDK1 HSL5 SRM5 YBR1211 YBR160W Cell division control protein 28 Cell division protein kinase 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES 57A7A2B97A90DC6C 57A7A2B97A90DC6C gbb_yeast Guanine nucleotide-binding protein subunit beta YOR50-2 YOR212W STE4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAAHQMDSITYSNNVTQQYIQPQSLQDISAVEDEIQNKIEAARQESKQLHAQINKAKHKIQDASLFQMANKVTSLTKNKINLKPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLRSDCSIATFSLFRGYEERTPTPTYMAANMEYNTAQSPQTLKSTSSSYLDNQGVVSLDFSASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSPDGLAVCTGSWDSTMKIWSPGYQ 4B0E26040AAA83E5 4B0E26040AAA83E5 ste5-ste4 2 6 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 D the Ste5-16E mutant showed normal protein levels (Figure 3C), and it still bound Ste4 The Ste5-16E mutant can still bind to Ste4. cdc28-ste5 1 5 enzyme enzyme unspecified role unspecified role spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 4 unspecified role unspecified role ancillary ancillary spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 3 enzyme target enzyme target substrate substrate unspecified role unspecified role P32917:p.[Thr4Glu;Ser11Glu;Thr29Glu;Ser43Glu;Ser69Glu;Ser71Glu;Ser81Glu;Thr102Glu] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Wed May 02 14:38:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr4glu,ser11glu,thr29glu,ser43glu,ser69glu,ser71glu,ser81glu,thr102glu' Tue Jun 30 17:56:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr4Glu;Ser11Glu;Thr29Glu;Ser43Glu;Ser69Glu;Ser71Glu;Ser81Glu;Thr102Glu]' n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P32917:p.[Thr4Ala;Ser11Ala;Thr29Ala;Ser43Ala;Ser69Ala;Ser71Ala;Ser81Ala;Thr102Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A Wed May 02 18:22:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr4ala,ser11ala,thr29ala,ser43ala,ser69ala,ser71ala,ser81ala,thr102ala' Tue Jun 30 17:14:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr4Ala;Ser11Ala;Thr29Ala;Ser43Ala;Ser69Ala;Ser71Ala;Ser81Ala;Thr102Ala]' ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation 5 A Purified Cln2/Cdc28 phosphorylated the WT Ste5 fragment, and this was severely reduced by the 8A or 8E mutations