MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1. Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1. EMBO J. (0261-4189) 2007 imex curation Moza B., Varma AK., Buonpane RA., Zhu P., Herfst CA., Nicholson MJ., Wilbuer AK., Seth NP., Wucherpfennig KW., McCormick JK., Kranz DM., Sundberg EJ. 2009-01-08 Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Moza B., Varma AK., Buonpane RA., Zhu P., Herfst CA., Nicholson MJ., Wilbuer AK., Seth NP., Wucherpfennig KW., McCormick JK., Kranz DM., Sundberg EJ. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1. Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1. EMBO J. (0261-4189) 2007 imex curation Moza B., Varma AK., Buonpane RA., Zhu P., Herfst CA., Nicholson MJ., Wilbuer AK., Seth NP., Wucherpfennig KW., McCormick JK., Kranz DM., Sundberg EJ. 2009-01-08 Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Moza B., Varma AK., Buonpane RA., Zhu P., Herfst CA., Nicholson MJ., Wilbuer AK., Seth NP., Wucherpfennig KW., McCormick JK., Kranz DM., Sundberg EJ. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation q8wlq7_human HLA-DR4 protein protein human Homo sapiens Human LEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDLLEQRRAEVDTYCRHNYGVV fragmentation type: fragment mint 7945616B9E5A2EB2 tsst_staau Toxic shock syndrome toxin-1 tst protein protein staau Staphylococcus aureus MNKKLLMNFFIVSPLLLATTATDFTPVPLSSNQIIKTAKASTNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN mint Responsible for the symptoms of toxic shock syndrome E95789FF9A1D7AB4 tvbl3_human T cell receptor beta variable 12-3 T-cell receptor beta chain V region YT35 TCRBV12S3 TRBV12-3 TCRBV8S1 protein protein human Homo sapiens Human MDSWTFCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL D9BF12E944882F14 hla_dr4-tst 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified TSST1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F4A EMBO-Journal kd 1 micromolar mint trbv12_3-tst 2 TSST1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F2 F1 EMBO-Journal non sono sicura se la hVbeta 2.1 sia quella giusta. mint