IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The role of Arabidopsis SCAR genes in ARP2-ARP3-dependent cell morphogenesis. The role of Arabidopsis SCAR genes in ARP2-ARP3-dependent cell morphogenesis. Development (0950-1991) 2007 imex curation Uhrig JF., Mutondo M., Zimmermann I., Deeks MJ., Machesky LM., Thomas P., Uhrig S., Rambke C., Hussey PJ., Hulskamp M. Note: It was not possible to include details of the actin polymerisation assays reported in this paper, since the Biosource of the actin is not given. The authors did not reply to requests for information , therefore the y axis of Table 1 is taken as the bait and the x axis the preys. Note : It was not always possible to add source text to the entries because some interactions were nor discussed in the text. martin.huelskamp@uni-koeln.de 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Uhrig JF., Mutondo M., Zimmermann I., Deeks MJ., Machesky LM., Thomas P., Uhrig S., Rambke C., Hussey PJ., Hulskamp M. Note: It was not possible to include details of the actin polymerisation assays reported in this paper, since the Biosource of the actin is not given. The authors did not reply to requests for information , therefore the y axis of Table 1 is taken as the bait and the x axis the preys. Note : It was not always possible to add source text to the entries because some interactions were nor discussed in the text. martin.huelskamp@uni-koeln.de Accepted 2007-Not a month!-13 by ORCHARD. Development (0950-1991) 2007 orchard Only protein-protein interactions imex curation The role of Arabidopsis SCAR genes in ARP2-ARP3-dependent cell morphogenesis. The role of Arabidopsis SCAR genes in ARP2-ARP3-dependent cell morphogenesis. Development (0950-1991) 2007 imex curation Uhrig JF., Mutondo M., Zimmermann I., Deeks MJ., Machesky LM., Thomas P., Uhrig S., Rambke C., Hussey PJ., Hulskamp M. Note: It was not possible to include details of the actin polymerisation assays reported in this paper, since the Biosource of the actin is not given. The authors did not reply to requests for information , therefore the y axis of Table 1 is taken as the bait and the x axis the preys. Note : It was not always possible to add source text to the entries because some interactions were nor discussed in the text. martin.huelskamp@uni-koeln.de 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Uhrig JF., Mutondo M., Zimmermann I., Deeks MJ., Machesky LM., Thomas P., Uhrig S., Rambke C., Hussey PJ., Hulskamp M. It was not possible to determine which tag was attached to the proteins studied in each BiFC assay. Note: It was not possible to include details of the actin polymerisation assays reported in this paper, since the Biosource of the actin is not given. The authors did not reply to requests for information , therefore the y axis of Table 1 is taken as the bait and the x axis the preys. Note : It was not always possible to add source text to the entries because some interactions were nor discussed in the text. martin.huelskamp@uni-koeln.de Accepted 2007-Not a month!-13 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Development (0950-1991) 2007 orchard Only protein-protein interactions imex curation rac2_arath Rac-like GTP-binding protein ARAC2 ARAC2 ROP7 MCL19.1 At5g45970 GTPase protein ROP7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPGIPIVLVGTKLDLRDDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVALRPPKAKKKIKPLKTKRSRICFFL B3E73F55BDBB8028 abil4_arath Protein ABIL4 Abl interactor-like protein 4 ABIL4 MJC20.13 At5g42030 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSTSLAIVLHQSSNHDELFMKQTLQFSETLKDLKNLRKQLYSAAEYFETSYGKAEHKETVIETLKEYAAKAVVNTVDHLGSVSDKFNSFLSDNSTHFSTTHLRLSSLEQRMRLCRDYMGKSGTHQHLLLFQYPRHHKRYFFPQQGRGTSFSAGDDSHRFTSAVRSTILENLPNTARKANKTGSFSFAPIVHNNINNRTPNKRSNSPMRFPLLRSGSLLKRSSSPSQPKKPPLALPEPQRAISVSRNTEIVEIKQSSSRKGKKILMFKALMSMSKSRN 4EAD6DAACB7F228A rac4_arath Rac-like GTP-binding protein ARAC4 ARAC4 ROP2 T20H2.12 At1g20090 GTPase protein ROP2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNKNRCAFL DIP protein Q38919 original sequence version: 65 DIP protein Q38919 original sequence version: 88 90899399AB7EA658 abil1_arath Protein ABIL1 Abl interactor-like protein 1 ABIL1 T3F17 At2g46225 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress METEISGMDNPAMTLDEVSMERNKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKALVNAVDHLGTVASKLTDLFDHQNSDISTMEMRASCVSQQLLTCRTYIDKEGLRQQQLLAVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSDAPASKSLSWHLGSETKSTLKGTSTVAPSSKDSKAFSKTSGVFHLLGDDENIANKKPLAGSQVSGVPAASTAHKDLEVPKLLTAHRSLDNNPRREIIQAPVRTKSVLSAFFVKQKTPKLKAGYVS 11C7CBC733886794 scar3_arath Protein SCAR3 Protein WAVE2 SCAR3 F28N24.14 At1g29170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPRNVYGMNQSEVYRNVDREDPKAILNGVAVTGLVGVLRQLGDLAEFAAEIFHGIQEEVMATASRSNQLKIRLQHIEATVPPLEKAMLAQTTHIHFAYTGGLEWHPRIPITQNHLIYDDLPHIIMDPYEECRGPPRLHLLDKFDINGPGSCLKRYSDPTYFRRASSNLSQGNKKFQKDKKHCKMKKKKTSSRSRDMSRLASLANQNARKTFASFSFSGQTSSTKTTSTSDMEKRYDFQDHHSRSFESRSGSGYNECLSTATSSLKTGERPKGVFVSSSLTPGSCTIASVLSECETEDAHDNFQFSPSQGQAARGSSCVSWDEKAEIVESLGLQTDEASEMVEANSVVDTLDEKPSYGEGIGGVDFHSKDNENDKSESGLRKRAGIDEVREIKNGREIVGEPRDSEQETESEGECFVDALNTIESESENNQGLQTSQVSSSCGVADERLEKSVCEQETEQNSYSVEDSCRSMDGLMANSFKNEENASSENVSVEMHQQNLQAGSDINRLQKNDLCANKDMRNDSGGKDTITFTFVPGLENSLVDSSNPLIHHGLQENQETEAESSGDLEAFKIWTNGGLLGLKPSKPPVLAMPSSLSPDCKTEERTVGFAEAEKDKADDLVENASHRHVLNNSSLATPGTQNPGSSNGIVMGIVDQRESHETSSGVFGLSHKFLTSGFRRKDSFAHDRKTVPATIPENDEVTTERRRFCDQDINEKTFMDPFRDEAPIDWITSSPPLQHMKISLNPADTLQASRLKLKFSDGDNTYNTFSSFQLLPETGTSLPDSYSDDDTFCRSSPYMSDTDYLSDNHSLSNSEPWEESSDSHGRKEQELYDSFHESRHVDNNAEASPLGIKSESSCVAVNLSYLQNPAEPLPPPFPPMQWMVSKTPSEKMEDKTQSLQLQEALRFAFEKHISLPTAKNELPSMVTSAPKPEIKAHLKNNVREEKQSANAKETETGDFLQQIRTQQFNLRPVVMTTTSSATATTDPIINTKISAILEKANSIRQAVASKDGDESDTWSDT 8082F565A5AA3FD0 abil2_arath Protein ABIL2 Abl interactor-like protein 2 ABIL2 F2K15.150 At3g49290 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPASHEASNYDEVSMQQSMLFSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKDYAVKALVNTVDHLGSVTYKVNDFIDEKVDEVSETELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDTPKFHKRYILPAGEIMTATNLEKLKYFGSSLEDADDWNQFRNAVRATIRETPPPPVRKSTSQSSSPRQPPQRSATFSFTSTIPKKEQDKRSVSPHRFPLLRSGSVATRKSASISRPTTPSKSRSITPIRYPSEPRRSASVRVAFEKDNQKETEQQQPSKSKRLLKALLSRRKTKKDDTLYTFLDEY 6CA00ACDD755888B arc2a_arath Actin-related protein 2/3 complex subunit 2A ARPC2A Actin-related protein C2A Arp2/3 complex 34 kDa subunit DIS2 Protein DISTORTED TRICHOMES 2 T17H7.13 At1g30825 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MILLQSHSRFLLQTLLTRAQNLDKAVELDYQWIEFDDVRYHVQVTMKNPNLLLLSVSLPNPPPEAMSFDGLPLGAIEAIKTTYGTGFQILDPPRDGFSLTLKLNFSKVRPDEELLTKLASIREVVMGAPLKIIFKHLASRTVAPELDRLVAIMHRPNETFFLVPQADKVTVAFPMRFKDSVDTILATSFLKEFVEARRAAALNTAPSCSWSPTAPQELEGAPKETLSANAGFVTFVIFPRHVEGKKLDRTVWNLSTFHAYVSYHVKFSEGFMHTRMRRRVESMIQALDQAKPLEKTRSMNNKSFKRLGLNEVNHTNSK 303D30BAC3EB3798 spk1_arath Guanine nucleotide exchange factor SPIKE 1 SPK1 FCAALL.346 dl4200c At4g16340 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENNNLGLRFRKLPRQPLALPKLDPLLDENLEQWPHLNQLVQCYGTEWVKDVNKYGHYENIRPDSFQTQIFEGPDTDTETEIRLASARSATIEEDVASISGRPFSDPGSSKHFGQPPLPAYEPAFDWENERAMIFGQRTPESPAASYSSGLKISVRVLSLAFQSGLVEPFFGSIALYNQERKEKLSEDFYFQIQPTEMQDAKLSSENRGVFYLDAPSASVCLLIQLEKTATEEGGVTSSVYSRKEPVHLTEREKQKLQVWSRIMPYRESFAWAVVPLFDNNLTTNTGESASPSSPLAPSMTASSSHDGVYEPIAKITSDGKQGYSGGSSVVVEISNLNKVKESYSEESIQDPKRKVHKPVKGVLRLEIEKHRNGHGDFEDLSENGSIINDSLDPTDRLSDLTLMKCPSSSSGGPRNGCSKWNSEDAKDVSRNLTSSCGTPDLNCYHAFDFCSTTRNEPFLHLFHCLYVYPVAVTLSRKRNPFIRVELRKDDTDIRKQPLEAIYPREPGVSLQKWVHTQVAVGARAASYHDEIKVSLPATWTPSHHLLFTFFHVDLQTKLEAPRPVVVGYASLPLSTYIHSRSDISLPVMRELVPHYLQESTKERLDYLEDGKNIFKLRLRLCSSLYPTNERVRDFCLEYDRHTLQTRPPWGSELLQAINSLKHVDSTALLQFLYPILNMLLHLIGNGGETLQVAAFRAMVDILTRVQQVSFDDADRNRFLVTYVDYSFDDFGGNQPPVYPGLATVWGSLARSKAKGYRVGPVYDDVLSMAWFFLELIVKSMALEQARLYDHNLPTGEDVPPMQLKESVFRCIMQLFDCLLTEVHERCKKGLSLAKRLNSSLAFFCYDLLYIIEPCQVYELVSLYMDKFSGVCQSVLHECKLTFLQIISDHDLFVEMPGRDPSDRNYLSSILIQELFLSLDHDELPLRAKGARILVILLCKHEFDARYQKAEDKLYIAQLYFPFVGQILDEMPVFYNLNATEKREVLIGVLQIVRNLDDTSLVKAWQQSIARTRLYFKLMEECLILFEHKKAADSILGGNNSRGPVSEGAGSPKYSERLSPAINNYLSEASRQEVRLEGTPDNGYLWQRVNSQLASPSQPYSLREALAQAQSSRIGASAQALRESLHPILRQKLELWEENVSATVSLQVLEITENFSSMAASHNIATDYGKLDCITTILTSFFSRNQSLAFWKAFFPIFNRIFDLHGATLMARENDRFLKQIAFHLLRLAVYRNDSVRKRAVIGLQILVKSSLYFMQTARLRALLTITLSELMSDVQVTHMKSDNTLEESGEARRLQQSLSEMADEAKSVNLLRECGLPDDTLLIIPEKFTENRWSWAEVKHLSDSLVLALDASLGHALLGSVMAMDRYAAAESFYKLGMAFAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVIMQALVARNDGVWSKDHVSALRKICPMVSGEFTTEASAAEVEGYGASKLTVDSAVKYLQLANKLFSQAELYHFCASILELVIPVYKSRKAYGQLAKCHTLLTNIYESILDQESNPIPFIDATYYRVGFYGEKFGKLDRKEYVYREPRDVRLGDIMEKLSHIYESRMDSNHILHIIPDSRQVKAEDLQAGVCYLQITAVDAVMEDEDLGSRRERIFSLSTGSVRARVFDRFLFDTPFTKNGKTQGGLEDQWKRRTVLQTEGSFPALVNRLLVTKSESLEFSPVENAIGMIETRTTALRNELEEPRSSDGDHLPRLQSLQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHFRLIGEEDQEFHTQLVNGFQSLTAELSHYIPAILSEL DIP protein Q8SAB7 original sequence version: 20 18CD66FB9B328A1F scar2_arath Protein SCAR2 WAVE4 Protein WAVE4 Protein DISTORTED 3 Protein IRREGULAR TRICHOME BRANCH 1 SCAR2 DIS3 ITB1 T19C21.7 At2g38440 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPLTRYQSRNEYGLADPDLYQAADKDDPEALLEGVAMAGLVGILRQLGDLAEFAAEMFHDLHEEVMATASRSHGLMARVQQLEAEFPSIEKALLCQTDHSPFFSNKGVEWHPNLQLEQSVVTSGDLPRCVMDSYEECRGPPRLFLLDKFDISGAGACLKRYTDPSFVRLETSSYEESWDDIQREKKSQKAKRRASQWRNGGTPENALSSHAKLHELFLEEHLEAHHSDPARVVKLKTRKLDGCSLISKSGESYMEKFVQTRVDSKISYEIITQNPGLLTWNMDSARDVVTDIPEISMVGAMDKSHGGSRAEVSFPSEQENVANVNMNGGFIEKDIETVPESTYNEVRGTTITQDSQTVLNGKPGFFQQRSYSEDLTSEADNYVDAPATMESETETDDECRPKSRSDTLKDGNHHIYSDAVEERMEDPPQFSFSHSNGNTPVSENGRSSFGKKSTSYSYSDTASISIDDQSDGEKLSGCLPSTSSFKSELVDSMSHVTPEANKVSHDLNVQESVSSSNVDGQTSLSSNGTCSSPRPVSQNDQSCSLTVQSLASEVVETSPELVRLDLMKGGNDGRKVDPFDSSKSCASFDAKNSDLPSETSSISSTSEGSRCDSTIEKNCMVASNLVNSGTSPQAFVDSQTGKQLPIADTDFETNSIVACSEVLANSGSDPEERDGRCLTGKLVPCSAGVGMEVSPDTPSKVCGPSSADGIHLKDTLDDETDCVSVTNVVVDVDSKNSVADVGSQSSVADIDSQSSVAEISDEHSCAFGNTADVSVSESHEDTLENGMSVPSDFNSGVEKLAGDASPTCSKCDDHISHEGFHDLSGLDNATTDIVPNVELDVSDNDNDTSSGGVNHAVSLSSTRGKGSLPWISTNTYQSSSDAGEIFHDTVVESDGTLLEDNNPESEIKMHKSPLEVSSEGLSTEPDNKDVESIESTSPKPSLDQRNRDTETKSPGESILDDNCIDSTQVYNLNLLESEAIDQAVREQTSYASHEVADEELLQSNVFRGLEFEPQSAGLEFAPQSAGIELNRPKQELNLDPTFPSFGFIPETIPPNPEDMPPLPPMQWLIGKVPHSFPTFMGESVETSSSALSAAPPIGSSLNVQIGSPPSELSVSLGSDESERLPGGFVHNASEKPLQSSIQFPTMSTDLNSQYDSSELPTIPYQECIEDFGSEENNLLADHAAQNHELVYSQASSLQLPQVKHEDFKDDADVHESQSSSDDHHCPETKSLTPTQSTKVEDKGHSVPDASNAETAESSNTSVQKINPVSVGDAMWPVSCFSVAPTLDTYKTEVVPTVRLPRPRSPLVDAVAAHDRRKMKKVSEMVHPPIKSKQDDKDSLLAQIRNKSVNLKPAVTTRPSIQTGPRTDLRVAAILEKANTIRMAMAGSDEDEDSDSWSDS CAC55D7CF3C8AEBC scar4_arath Protein SCAR4 SCAR4 F7A7.250 At5g01730 Protein WAVE3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MALTRYQIRNEYGLADKELYQSADKEDPEALLEAASMAGLVGVLRQLGDLSEFAAEVFHCLHEQLMTTAARGHGLAMRLQHLEADFPSVEIPILSQTDHSTFFYEPGLEWHSDLQTKEDLISPRNLPRCIMDSYEECHGPPQLFLLDKFDVAGSGSCLKRYSDPSLLKTHTTSAVVATSKLGKDKRLRQSKKKGSHTTIKETPEDSRTSHAKLHQLFFLEHVENGHRNPEFHVKLKRRQLNGPPINSSSGASYMEKFLKNSSPYCERVHGTMDQSSPAMETEVTVCSEQEDLPIPSLVYSNSGGTRKYNEMEIESIAGHEILEIPFVPHEITVNEKSPVVCLESSSSVNLCCKTNNDADSPASTESEVKEAGSDDKAGCDHGFPGFGQPQICTNAEVNQTEVLTQFSNVLRHSPEEGESSLLCTDIQRASPESKPHKAEEAAVDLDESFSQMTPDIDSAGMGTLEILQTPFSLSCYESPANLPEDSGSHLELQSNKANAEACEVFEVRRDPMLNISPETHLLKVTQVPQDAYEGGTNDVHSQHVFSVETASEISVSALVEDQFSSITNQEIEALESEDISSEAGHFIPDTKKSLNETSVALESDFLLPNHYISTFDNFEDLSLSADAQDYAAPKEDETNSQDGSSMNPAQSKHISTSEISSENGTLMSDTPRDLHTGYGSLSASSCLEDGLANPDLAEISSYSGQEDPQTMSIVSDDSSDPEVPIPDGTCFAGDVDHDNQTGLNNKAIETVPQKELETISDPQESLLGTEECLSSEYCLQIQNQRQESPSETGSANSRTSSDESPPTQNGSVGVQSSPLDVFPSSITEIEALHAPYQEIFTSLNDHISESVLSKGLTDEEDFLNVSPESILPLSTSLHETPQANPEITPPLPPLPPTQWWMGKLVESTEMPSLAGSGNNSFNIQRDENTQNGSVQANEAQYPSEVSVTDGENHNFHIYTEESKATEEQSPSGVNGTSDTYMESKHKCLNRTPEDSFSLAESAQGLEADWRTEAMALEWFSQNLREHNNPHPAKLEEEEPQVDHPLEKPGQTKFRQTLRDNNSYNQNQKAGKLKRDEDTLVIGIDRSMLRKVSEGNRTHVGARVDENDSLLEIIRSKSFNLRPADASGRPNFQVAVPKTNLKVAAILEKANTLRQAMAGSDDEHDSDSWSE 96522221853ED25D rac10_arath Rac-like GTP-binding protein ARAC10 ARAC10 ROP11 MQB2.20 MQB2.180 At5g62880 GTPase protein ROP11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGLSPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSAIKEVIKPLVKQKEKTKKKKKQKSNHGCLSNVLCGRIVTRH DIP protein O82481 original sequence version: 90 02575631F7582E3B rac6_arath Rac-like GTP-binding protein ARAC6 T19K4.80 ARAC6 RAC2 ROP5 F4B14_220 At4g35950 GTPase protein ROP5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQPPKQKKKKNKAQKACSIL DIP protein Q9SBJ6 original sequence version: 53 D26BE6D3827C1632 pir_arath Protein PIR PIR of plants Protein PIROGI Protein KLUNKER PIR KLK PIRP F20L16.130 At5g18410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVPVEEAIAALSTFSLEDEQPEVQGPAVMVSAERAATDSPIEYSDVAAYRLSLSEDTKALNQLNTLIQEGKEMASILYTYRSCVKALPQLPESMKHSQADLYLETYQVLDLEMSRLREIQRWQSSASAKLAADMQRFSRPERRINGPTVTHLWSMLKLLDVLVQLDHLKNAKASIPNDFSWYKRTFTQVSAQWQDTDTMREELDDLQIFLSTRWAILLNLHVEMFRVNNVEDILQVLIVFIVESLELDFALLFPERYILLRVLPVLVVLATPSEKDTEALYKRVKLNRLINIFKNDPVIPAFPDLHLSPAAILKELSVYFQKFSSQTRLLTLPAPHELPPREALEYQRHYLIVNHIGALRAEHDDFTIRFASSMNQLLLLKSNDGAYTEWCREVKGNMYDMVVEGFQLLSRWTARIWEQCAWKFSRPCRDAGETPEASGSYSDYEKVVRFNYTAEERKALVELVGYIKSVGSMLQRCDTLVADALWETIHAEVQDFVQNTLATMLRTTFRKKKDLSRILSDMRTLSADWMANTRPEHEMPSSQHGNDESRGNFFYPRPVAPTAAQVHCLQFLIYEVVSGGNLRRPGGFFGNNGSEIPVNDLKQLETFFYKLSFFLHILDYSASIGILTDLGFLWFREFYLESSRVIQFPIECSLPWMLIDYILEAQNSGLLESVLLPFDIYNDSAQQALVVLRQRFLYDEIEAEVDHGFDIFVSRLSESIFTYYKSWSASELLDPSFLFALDNGEKFSIQPVRFTALFKMTKVKILGRTINLRSLIAQRMNRIFRENLEFLFDRFESQDLCAVVELEKLIDILKHSHELLSQDLSIDPFSLMLNEMQENISLVSFSSRLATQIWSEMQSDFLPNFILCNTTQRFVRSSKVPPTQKPSVPSAKPSFYCGTQDLNAAHQSFARLHSGFFGIPHLFSIVKLLGSRSLPWLIRALLDHISNKITTLEPMISGLQEALPKSIGLLSFDGGVTGCMKLIREQLNWGTKSELKSEVLRGIKEIGSVIYTMGLLDIVLREVDTKRFMQTAPWLGLIPGAEGQIVNAQDGESPLVNLLKSATSAVVSSPGCLNPAAFYTMSKQAEAADLLYKANMNGGSVLEYTLAFTSASLDKYCSKWSAPPKTGFVDITTSKDFYRIYGGLQIGYLEEITAPQSAQHEVLGDSIAWGGCTIIYLLGQQLHFELFDFSYQVLNVSEVETVSASHTHRNPQIHQGWEGLLEGMKKARRLNNHVFSMLKARCPLEDKTACAIKQSGAPLPRVRFENTVSAFETLPQKGTVG DIP protein Q5S2C3 original sequence version: 25 3755F9E5D025D55E arc5a_arath Actin-related protein 2/3 complex subunit 5A ARPC5A Actin-related protein C5A Arp2/3 complex 16 kDa subunit CRK Protein CROOKED T15B16.22 At4g01710 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEFVEADNAEAIIARIETKSRKIESLLKQYKHVEALKTALEGSPPKTRDERCKSANWIVVHRALMAIKDIDGMLNALDVEYYDILMKYLYRGLSTGDRPTCDQCLKIHEKLTERAGLGCILRCLTDTINTV DC3AADCC46390942 arp2_arath Actin-related protein 2 WRM Protein WURM MOJ10.7 ARP2 At3g27000 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNKNVVVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLMEQQVKDIVVGETCSELRHQLDINYPVHNGIVQNWDDMEHVWDHAFYNELKINPSDCKILLTDPPLNPSKNREKMIETMFEKYNFAGVFIQIQAVLTLYAQGLLTGLVIDSGDGVTHVVPVVDGYSFPHLTKRMNVAGRHITAYLVDLLSRRGYAMNKTADFETVREIKEKLCYISYDYKRESQLGLETTILVKNYTLPDGRVIKVGTERFQAPEALFTPELIDVEGDGMADMVFRCIQEMDIDNRMMLYQHIVLSGGSTMYPGLPSRLEKEIQDRYLDTVLKGNKDGLKKLRLRIEDPPRRKHMVYLGGAVLAGIMKDAPEFWINREDYMEEGINCLNKMSQA DE10C27051F8E11B brk1_arath Protein BRICK 1 BRK1 T9I22.8 At2g22640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFESTTKSKLASLNEKLDLLERRLEMLEVQVSTATANPSLFAT CEF8D18BEB4B761C arpc3_arath Actin-related protein 2/3 complex subunit 3 ARPC3 Actin-related protein C3 Arp2/3 complex 21 kDa subunit T13D8.30 At1g60430 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVYHSSFVDEEGVTKACGCPLLPLKSHIKGPAPVSEQDKTDIVDEAITFFRANVFFTNFDIKSPADKLLIYLTFYINVALKRLEGCRTLAVGTKAIINLGLEDIPVPGETGFPFPGLFSLPQSQDEAELFRNYLKQVREETSGRLLSVAYRANGTPNKWWLAFAKRKFMNVVVL 9383A162D10E62CA rac9_arath Rac-like GTP-binding protein ARAC9 ARAC9 ROP8 F16B22.18 At2g44690 GTPase protein ROP8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASMAATSTSSATATTFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFNANVLVDGKTVNLGLWDTAGQEDYNRVRPLSYRGADVFILAFSLISRPSFENIAKKWVPELRHYAPTVPIVLVGTKSDLRDNMQFPKNYPGACTIFPEQGQELRKEIGALAYIECSSKAQMNVKAVFDEAIKVVLHPPSKTKKRKRKIGLCHVL B09E41B1E86F00C9 scarl_arath Scar-like domain-containing protein WAVE 5 WAVE5 F28J12.260 At4g18600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPLVRFKIRNELSLGGPEIQRSASVEDEEPKAILGAVEVAGLIGILRQLGDLAEFSAEVFNGLQEEVTVTASRCQKLTSRVRRIESALSPLEKAVLSQTSHIHFAYTAGSEWHPRIRNGHSHFVQSDLPLCVMESYEQCRDPPPLHLLDRFAVGGPGSCLRKYSDPTFFRKELSNPSKTDDIKVQRDQAHRKRKKKRLPQRNICRSNAVSTSDETNGAHLSSFTDDRPTTSRSTSTVDMPRSSNMQDLSDIVDQSYLQGQSGAQEQSEAQVQSDFQESSKARDSITGSGYIEYVINQSPVDKPEVKLVEGFLSGSLCPADRIGSTVPEGCIEVVDDNILYSPSEDLLVPSASNVCDEKKETLESMVEKSRKDDEPSELHESKFGPVTPDRVRQNQRDFDRTYILFDEVDIVGEKQSKSQANNIDGTLGIENEGEDKSEQESEADEFVDARNTIESESESDIDGVPKPKLEHYFGDISTYCSEDANSDNNDGSEDITYEEMAHDPRHENSEDESCSGSYLPEDSNVSSCLSDPVCEETLFHDENSQKPWEFFTMCPSLLAEKAVPDVTILREEPVMAHPLFAGDSANEKISSEERIISCPSLKDAIPAEKILPEEHLVNYPSLEAIPHEKILPGESIAKYPSFAEIIPQEKILSEKSLEEAVLDNMTPAGEPDAAHPSFPKAVQDKKISPEVLDSKIFSVPKAVSQEPISLEEFVRIHPCLAEAVPDERFLIEEPPSTCLSLTKAMPTEILLPEKTLESSHYLEELPEEDILQEKSVDSTHPSCAKAAAETNLSPEVLDSTKLSVAEAVPQEQVSLEEFVGINPCLVEAVPDERLLPEEPDTTYLSLTKAVAIEKVLSEELLETYPSLAELPEEEFLQEETDDATHTSEAVSDEEISQEVSDSTNLSLEEALPLEHISHEEFVGIDQCLVEVAPEERFLPEEPVITCLSLTMEGVLSEKSPETYPSLSELPEEKILDEEADDAMHPCLSEAVSDEQSSPNVLGSTNSPVAEAVPQAQISVEEFVGIDPCLVEAVPDMRDLPEEHITSCIYLTNVVPIEEVLPEEPFEACASLGKLPKDKISQEESDEATHTLSCAKAESDEHVSLEVLNSTNLSAAEAIPNEQVTLDEFVGIDPCLGEVVLDEEVLPEQLDTTCRSLTKAAPIMTIFPEEPPEVYPSLEELPEEKIAQEEEVDDATHPYFSEAVCDEKIPPLEDPGSTHPSLEESVPYEEASHEELVGTNPFLESAFPNEIGFPDEPGVTYRSSAEAVSKEKNLPEESLPTYPSWAEVVPDEKISREELDSTYPSSAEAVFDENISGSEAPGSTTETGRQNKTFPEKTFATENSLNEAVFDEKIPGSEASTSTTETGPHNKTFPEEPFAMENFLNEAVFDEKIPGSEAPVSTTETGLHNETFTEEPVATDISLNEAVFGEIIPGSEAPGSATETGLHNKTFPEKPFATDLSLKEAVFDEKIPGSEASSSTTETSPHNKTFPRETITTDLSSTEAVFDEKITGSGVPSFTTETGSHNKCFPEEPVPKENILPKEPAAAYLALAEGIPDQKVFLDDAALLLFAEAIFDQKFSPEVPDSTYPSLKEPEMHVAAPCVVTDLPAKNIKVKEGEVHNEPYTASDVSMNQKSGLLEPESTERTFPSSGGTVTISPDTQNSLPNGTSVESISIWSNGGLLGLAPLKPPVFAEPNSGSQHIKHEINEASVLSTRKQESSSRSVENAEKSSLPLIVSDPTSQQQSNMSSLSPMQSTGTSFRVFGLSHRLLMAGFRGNSSSTCKFESVPSSSYDTRVAAIEDRTQQSPGGSSFEEQLDYESSLFGSPTSSPPVEHMKISFNPIEASPVPKLKLRIPCQPRYNGENADMFPSFQLVPEASNSDDGDDNSDTFCQSSPCVSDYCLSDSELWESDESPRISVSSLKQVEERSRHGDMGSFSGSFLDLPCYDAVDHQSTFSRLEQEQVPEYKPSVSEIIRAWPPNQPKSSPCNEANVDANTVSKKTQDQSLGLVATDDEGGDSVCLDEHKTKGI 3353E9158616F0E2 abil3_arath Protein ABIL3 ABIL3 MOP9.13 At5g24310 Abl interactor-like protein 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAAATMPMPREASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDTPKFHKRYFLPSGEIKRGGNLAKLKNVEGSFDGEDDWNQFRNAVRATIRETPPPPVRKPILQSPSQRKPQRSATFSFSSIATAPKKEQDKRAVSPHRFPLLRSGSVAIRPSSISRPTTPSKSRAVTPTPKRYPSEPRRSASVRVAFEKEAQKEPEHQQQPSKSKRLLKALLSRRKTKKDDTLYTYLDEY 46452BE2FB967E93 arc1b_arath Actin-related protein 2/3 complex subunit 1B ARPC1B Actin-related protein C1 Actin-related protein C1B Arp2/3 complex 41 kDa subunit p41-ARC F16D14.14 At2g31300 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVVDVHRFAESITCHAWSPDLSMVALCPNNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSLEGAEWVPTLVILRLNRAALCVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSVTSVAWHPNNVLLATTSTDGKCRVFSTFIKGVDTKDSKAGSPAETKFGEQILQLDLSYSWAFGVKWSPSGNTLAYVGHSSMIYFVDDVGPSPLAQSVAFRDLPLRDVLFISEKMVIGVGYDSNPMVFAADDTGIWSFIRYIGEKKAASSGSSYSSQFSEAFGKFYGSQSKSTTANDASDSRGGVHDNSITSIVPLGKGGSPKVMRFSTSGLDGKIAIWDLENMQQELGNQF C96E4329C1667ED8 arpc4_arath Actin-related protein 2/3 complex subunit 4 Actin-related protein C4 Arp2/3 complex 20 kDa subunit FCAALL.159 dl3115c At4g14147 ARPC4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANSLRLYLACIKNTLEAAMCLQNFPCQEVERHNKPEVELKTSPELLLNPVLICRNEAEKCLIETSINSLRISLKVKQADELENILTKKFLRFLSMRAEAFQVLRRKPVQGYDISFLITNYHCEEMQKQKLIDFIIQFMEDIEKEIRDLKESVNTRGRLVATEFLKQFM 5CB3BFF947D083AF arp3_arath Actin-related protein 3 Protein DISTORTED TRICHOMES 1 F3F19.20 ARP3 DIS1 At1g13180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPTSRPAIVIDNGTGYTKMGFAGNVEPCFILPTVVAVNESFLNQSKSSSKATWQTQHNAGVAADLDFYIGDEALAKSRSSSTHNLHYPIEHGQVEDWDAMERYWQQCIFNYLRCDPEDHYFLLTESPLTPPESREYTGEILFETFNVPGLYIAVNSVLALAAGYTTSKCEMTGVVVDVGDGATHVVPVAEGYVIGSCIKSIPIAGKDVTLFIQQLMRERGENIPPEDSFDVARKVKEMYCYTCSDIVKEFNKHDKEPAKYIKQWKGVKPKTGAPYTCDVGYERFLGPEVFFNPEIYSNDFTTTLPAVIDKCIQSAPIDTRRALYKNIVLSGGSTMFKDFGRRLQRDLKKIVDARVLANNARTGGEITSQPVEVNVVSHPVQRFAVWFGGSVLSSTPEFFASCRTKEEYEEYGASICRTNPVFKGMY 55F03ED31CB52E80 nckp1_arath Protein NAP1 Nck-associated protein 1 p125Nap1 NAP of plants ARP2/3 regulatory protein subunit NAPP Protein GNARLED NAP1 GRL NAP NAPP T4C15.22 At2g35110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANSRQYYPSQDESMSPTSVRSREWEGPSRWTEYLGPEMAASVSSTRSSKQIDGHVGGSTKALNIQWVVQMIEVADGLMAKMYRLNQILEYPDPVGHVFSEAFWKAGVFPNHPRICTLLSKKFPEHFSKLQLERIDKFSLDSLHDGAELHLQSLEPWIQLLLDLMAFREQALRLILDLSSTVITLLPHQNSLILHAFMDLFCAFVRVNLFAEKIPRKMLLQVYNLLHALSRNDRDCDFYHRLVQFIDSYDPPLKGLQEDLNFVSPRIGEVLEAVGPSIFLSADTRKLRNEGFLSPYHPRFPDILTNSAHPMRAQDLANVTSYREWVLLGYLVCPDELLRVTSIDIALVVLKENLVVTLFRDEVSLYQMVCEKEFGIGISFASADSINLTMQYILLHEDYQLYVLPRVLESKKMAKSGRTKQKEADLEYSVAKQVEKMISEVHEQALQLCDTIHRERRILLKQEIGRMVLFFTDQPSLLAPNIQMVFSALALAQSEVLWYFQHAGIASSRSKAARVIPVDIDPNDPTIGFLLDGMDRLCCLVRKYISAARGYALSYLSSSAGRIRYLMGTPGIVALDLDPTLKGLFQRIVQHLESIPKAQGENVSAITCDLSDFRKDWLSILMIVTSSRSSINIRHLEKATVSTGKEGLLSEGNAAYNWSRCVDELESQLSKHGSLKKLYFYHQHLTTVFRNTMFGPEGRPQHCCAWLSVASSFPECASLIIPEEVTKFGRDAVLYVESLIESIMGGLEGLINILDSEGGFGALESQLLPEQAAAYLNNASRISAPSVKSPRVVGGFTLPGHESYPENNKSIKMLEAAIQRLTNLCSILNDMEPICVINHVFVLREYMRECILGNFKRRFLTALQTDNDLQRPSVLESLIRRHMGIVHLAEQHVSMDLTQGIREILLTEAFSGPVSSLHTFEKPAEQQQTTGSAVEVVCNWYMDNIIKDVSGAGILFAPRHKYFKSTRPVGGYFAESVTDLKELQAFVRIFGGYGVDRLDRMMKVHTAALVNCIETSLRSNRELIEAAAASMHSGDRVERDASVRQIVDLDTVIGFCIEAGQALAFDDLLAEASGAVLEDNASLIHSMISGIVEHIPEEIPEKKEIRRIKGVANGVGVAGDHDSEWVRLILEEVGGANDNSWSLLPYFFASFMTSNAWNTTGFNIETGGFSNNIHCLARCISAVIAGSEYVRLQREYQQQHQSLSNGHHSSENLDSEFPPRVTAEASIKSSMLLFVKFAASIVLDSWSEANRSHLVAKLIFLDQLCEISPYLPRSSLESHVPYTILRSIYTQYYSNTPSTPLSTASPYHSPSVSLIHASPSMKNSTTPQRGSGSGSSSTAAPDSGYFKGSSSSLYGQEHYTESETGNSRNNENNNNNKQRGSSRRSGPLDYSSSHKGGSGSNSTGPSPLPRFAVSRSGPISYKQHN DIP protein Q5S2C4 original sequence version: 24 A2008CEC598BB6F1 scar1_arath Protein SCAR1 Protein WAVE1 SCAR1 T14G11.27 At2g34150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPLVRLQVRNVYGLGQKELHTKVDREDPKAILDDVAVSGLVGILRQLGDLTEFAAEIFHGIQEEVMITASRSNKLKMRLKQIEAKVPTIQKTVLAQTNHIHFAYTGGLEWHPRIPNVQNHFMYDELPPFIMTPYEDCREPPRLHLLDKFDINGPGSCLKRYSDPTHFKRASRASKPSEIKKKKSIQRGRDISRLASVANQSDRKTCTSLSFSGRTSTSKTASTIEIESKSDLQEHRSFSFDSRSGGEKPKRVSSSSRFTPGSRTIASVLSESESESDSPSQDLTARGSSSVSWHEKAEIVECNVLQCATDEAPEVMETNFVLDAEPVSRLKEHSAVEAVQDIKPKELEMDNEDETESEGDDFVDALYTIDSESENDEAFQATKEVQKNLYNDITEQETEKISNNFSVDETKCAATSELHLSSSPVYKSDELIHQDPWAASEISSGTHSYSNGFSNPLYDISGIQEHQESEEVESSCDTESIKTWTNGNLLGLKPSKPKIIAETIPEIVEDIDSETFQEHLREDYKAPFDWFTSSPPLDHMKISFKSSETLPSSELQLKLPDEYTFSSFQLVPETIATSLPDSDSDKDTFCRSSSYISDNSDNDNRSVSMSEQQWEEESEGIRESKRQQELYDSFHRVNAEASSLPVPFPKIETTNGCLVENVSYLQNPAEPLPPPLPPLQWMVSKIPSAGFEDNNKQSLKDALTQAFEKNNNSLTAVKKKEPHIVTVSDPKLVTKVHLKNNVRDYKQSHGNTNETEAGDFLHQIRTKQFNLRRVVRTKTSSSETTMNTNISVILEKANSIRQAVASDDGEGESDTWSDSDT 67DB3E28A60F6115 arp3-arp2 1 25 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Table 1 Our data indicate additionally direct contact between ARP2 and ARP3. abi1-arp2 1 6 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Table 1 abi1-arp3 1 6 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association Table 1 abi2-arp3 1 25 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 1 We identified interactions between both ARP3 and ARPC3 and AtSCAR3, HSPC300/BRICK1 and ABI1 and 2. brick1-arp3 1 18 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association Table 1 We identified interactions between both ARP3 and ARPC3 and AtSCAR3, HSPC300/BRICK1 and ABI1 and 2. scar3-arp3-1 1 25 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 1 We identified interactions between both ARP3 and ARPC3 and AtSCAR3, HSPC300/BRICK1 and ABI1 and 2. abi4-arp3 1 8 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association Table 1 ABI4 interacted only with ARP3. arpc4-arpc1 1 24 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey physical association physical association Table 1 arpc4-arpc2 1 9 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait physical association physical association Table 1 scar3-arpc2 1 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Table 1 arpc4-arpc3 1 19 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait physical association physical association Table 1 abi1-arpc3 1 6 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association Table 1 abi2-arpc3-1 1 19 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 1 brick1-arpc3-2 1 19 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association Table 1 Interaction could be detected between HSPC300/BRICK1 and AtSCAR1, 2 and 3, scar1-arpc3 1 19 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait physical association physical association Table 1 Furthermore, AtSCAR1 and AtSCAR2 have been found to interact with ARPC3. AtSCAR4, AtSCAR-LIKE scar2-arpc3 1 19 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 Furthermore, AtSCAR1 and AtSCAR2 have been found to interact with ARPC3. AtSCAR4, AtSCAR-LIKE scar3-arpc3 1 7 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association Table 1 Furthermore, AtSCAR1 and AtSCAR2 have been found to interact with ARPC3. AtSCAR4, AtSCAR-LIKE arpc5-arpc4 1 24 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Table 1 nap125 1 26 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey physical association physical association Table 1 We further found that NAP1 also homodimerises and interacts with two ABI proteins (ABI 1 and 2) and with SRA1 klk-nap125 1 15 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey physical association physical association Table 1 abi1-nap125 1 6 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey physical association physical association Table 1 abi2-nap125 1 26 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 1 brick1-abi1 1 6 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association Table 1 We found that BRICK1 homodimerises, and physically interacts with all four ABI proteins. scar1-abi1 1 6 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait physical association physical association Table 1 scar2-abi1 1 6 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 scar3-abi1 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 1 Interaction with all four ABI proteins was found in the case of AtSCAR3 only. scar_like-abi1-1 1 6 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association Table 1 spike-abi1 1 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Table 1 brick1-abi2 1 18 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Table 1 We found that BRICK1 homodimerises, and physically interacts with all four ABI proteins. scar1-abi2-1 1 27 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Table 1 scar2-abi2 1 11 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association Table 1 scar3-abi2 1 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Table 1 Interaction with all four ABI proteins was found in the case of AtSCAR3 only. scar_like-abi2-1 1 8 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association Table 1 spike-abi2-2 1 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 brick1-abi3 1 22 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association Table 1 We found that BRICK1 homodimerises, and physically interacts with all four ABI proteins. scar3-abi3 1 22 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 1 Interaction with all four ABI proteins was found in the case of AtSCAR3 only. brick1-abi4 1 18 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Table 1 We found that BRICK1 homodimerises, and physically interacts with all four ABI proteins. scar2-abi4-1 1 4 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 scar3-abi4-2 1 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 1 spike-abi4-2 1 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 brick1 1 18 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Table 1 We found that BRICK1 homodimerises, and physically interacts with all four ABI proteins. scar1-brick1 1 18 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait physical association physical association Table 1 scar2-brick1 1 11 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey physical association physical association Table 1 scar3-brick1 1 7 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Table 1 spike-scar1 1 10 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey physical association physical association Table 1 rop5-scar1-1 1 14 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey physical association physical association Table 1 The unmodified ROP5 interacted with AtSCAR1, AtSCAR2 and AtSCAR4; The constitutively active (CA) form of ROP5 did not interact with the prey protein. The authors did not provide details concerning the constitutively active (CA) form of ROP5. rop8-scar1-2 1 20 unspecified role unspecified role bait bait Q9XGU0:p.Gly27Val mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G V Wed May 02 17:16:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly27val' Tue Jun 30 19:32:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly27Val' 27 unspecified role unspecified role prey prey physical association physical association Table 1 ROP8 interacted in both forms with AtSCAR2 and AtSCAR3, whereas only the unmodified form interacted with AtSCAR1, The constitutively active (CA) form of ROP8 (Gly27Val) did not interact with the prey protein. rop11-scar1 1 13 unspecified role unspecified role bait bait O82481:p.Gly17Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 18:49:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly17val' Tue Jun 30 20:06:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly17Val' 27 unspecified role unspecified role prey prey physical association physical association Table 1 constitutively active ROP11 interacted with AtSCAR1, AtSCAR2 and AtSCAR4 Only the constitutively active (CA) form of ROP8 (Gly17Val) interacted with the prey protein. spike-scar2 1 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Table 1 rop5-scar2 1 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Table 1 The unmodified ROP5 interacted with AtSCAR1, AtSCAR2 and AtSCAR4; The constitutively active (CA) form of ROP5 did not interact with the prey protein. The authors did not provide details concerning the constitutively active (CA) form of ROP5. rop8-scar2 1 11 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Table 1 ROP8 interacted in both forms with AtSCAR2 and AtSCAR3, whereas only the unmodified form interacted with AtSCAR1, rop11-scar2 1 13 unspecified role unspecified role bait bait O82481:p.Gly17Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 15:39:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly17val' Tue Jun 30 16:36:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly17Val' 11 unspecified role unspecified role prey prey physical association physical association Table 1 constitutively active ROP11 interacted with AtSCAR1, AtSCAR2 and AtSCAR4 Only the constitutively active (CA) form of ROP8 (Gly17Val) interacted with the prey protein. rop7-scar2 1 11 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait Q38903:p.Thr20Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T D Wed May 02 15:19:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr20asp' Tue Jun 30 18:02:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr20Asp' physical association physical association Table 1 ROP8 interacted in both forms with AtSCAR2 and AtSCAR3, whereas only the unmodified form interacted with AtSCAR1, The prey protein did not interact with the dominant negative form the (Threonine 20 to Asparagine exchange (ROP7DN)) of the bait protein. spike-scar3 1 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Table 1 rop8-scar3 1 7 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Table 1 ROP8 interacted in both forms with AtSCAR2 and AtSCAR3, whereas only the unmodified form interacted with AtSCAR1, spike-scar4 1 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Table 1 rop5-scar4 1 12 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Table 1 The unmodified ROP5 interacted with AtSCAR1, AtSCAR2 and AtSCAR4; The constitutively active (CA) form of ROP5 did not interact with the prey protein. The authors did not provide details concerning the constitutively active (CA) form of ROP5. rop11-scar4 1 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait O82481:p.Gly17Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 19:17:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly17val' Tue Jun 30 16:07:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly17Val' physical association physical association Table 1 constitutively active ROP11 interacted with AtSCAR1, AtSCAR2 and AtSCAR4 Only the constitutively active (CA) form of ROP8 (Gly17Val) interacted with the prey protein. rop8-scar_like 1 21 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait Q9XGU0:p.Gly27Val mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G V Wed May 02 14:26:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly27val' Tue Jun 30 17:57:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly27Val' physical association physical association Table 1 ROP8 interacted in both forms with AtSCAR2 and AtSCAR3, whereas only the unmodified form interacted with AtSCAR1, The constitutively active (CA) form of ROP8 (Gly27Val) did not interact with the prey protein. spike 1 10 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 rop2-spike 1 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 rop5-spike1 1 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Table 1 The constitutively active (CA) form of ROP5 did not interact with the prey protein. The authors did not provide details concerning the constitutively active (CA) form of ROP5. rop8-spike1 1 20 unspecified role unspecified role bait bait Q9XGU0:p.Gly27Val mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G V Wed May 02 15:34:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly27val' Tue Jun 30 18:55:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly27Val' 10 unspecified role unspecified role prey prey physical association physical association Table 1 The constitutively active (CA) form of ROP8 (Gly27Val) did not interact with the prey protein. rop11-spike 1 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait O82481:p.Gly17Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 16:06:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly17val' Tue Jun 30 15:39:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly17Val' physical association physical association Table 1 constitutively active ROP11 interacted with AtSCAR1, AtSCAR2 and AtSCAR4 Only the constitutively active (CA) form of ROP8 (Gly17Val) interacted with the prey protein. spike-abi3 1 22 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 arpc4-arpc3-1 2 19 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. arpc4-arpc2-1 2 9 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. brick1-arp3-1 2 25 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. brick1-arpc3-3 2 19 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. brick1-abi4-1 2 18 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. brick1-1 2 18 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. scar1-arpc3-1 2 19 unspecified role unspecified role neutral component neutral component 27 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. scar2-arpc3-2 2 11 unspecified role unspecified role neutral component neutral component c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. scar2-abi1-1 2 11 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. scar2-abi4-2 2 11 unspecified role unspecified role neutral component neutral component c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. scar2-brick1-1 2 18 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. scar3-arpc2-1 2 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. scar3-abi4-3 2 7 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. scar3-brick1-1 2 18 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. spike-abi1-1 2 6 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. spike-scar2-1 2 10 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 spike-1 2 10 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. rop2-scar2 2 11 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein. rop7-scar2-1 2 3 unspecified role unspecified role neutral component neutral component Q38903:p.Thr20Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T D Wed May 02 19:34:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr20asp' Tue Jun 30 17:44:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr20Asp' 11 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 The prey protein did not interact with the dominant negative form the (Threonine 20 to Asparagine exchange (ROP7DN)) of the bait protein. It was not possible to assign tags used in the BiFC assay to each protein. rop8-scar2-1 2 11 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Table 1 It was not possible to assign tags used in the BiFC assay to each protein.