MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Pin1 stabilizes Emi1 during G2 phase by preventing its association with SCF(betatrcp). Pin1 stabilizes Emi1 during G2 phase by preventing its association with SCF(betatrcp). EMBO Rep. (1469-221X) 2007 imex curation Bernis C., Vigneron S., Burgess A., Labbé JC., Fesquet D., Castro A., Lorca T. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Bernis C., Vigneron S., Burgess A., Labbé JC., Fesquet D., Castro A., Lorca T. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation Pin1 stabilizes Emi1 during G2 phase by preventing its association with SCF(betatrcp). Pin1 stabilizes Emi1 during G2 phase by preventing its association with SCF(betatrcp). EMBO Rep. (1469-221X) 2007 imex curation Bernis C., Vigneron S., Burgess A., Labbé JC., Fesquet D., Castro A., Lorca T. 2009-01-08 Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bernis C., Vigneron S., Burgess A., Labbé JC., Fesquet D., Castro A., Lorca T. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation Pin1 stabilizes Emi1 during G2 phase by preventing its association with SCF(betatrcp). Pin1 stabilizes Emi1 during G2 phase by preventing its association with SCF(betatrcp). EMBO Rep. (1469-221X) 2007 imex curation Bernis C., Vigneron S., Burgess A., Labbé JC., Fesquet D., Castro A., Lorca T. 2009-01-08 Only protein-protein interactions xenla-xl2 Xenopus laevis tadpole cell line XL2 xl2 Xenopus laevis tadpole cell line XL2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bernis C., Vigneron S., Burgess A., Labbé JC., Fesquet D., Castro A., Lorca T. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation fbx5a_xenla F-box only protein 5-A fbxo5-a Early mitotic inhibitor 1-A emi1-a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MMCGFASNQSPKKLSSKKSSATNVHLEISPVKHHPPCKVYENVQGSCLDSAICTTVAKCADLTDDLPVHNKENLLHRLNDLETNSYEEYSALQDSGYSSILQNDSPCQDETDRKVSDIQVRETPKNFMSYQRPFHTLSKINLPILRFEEAVCSTLKKMRKTNKKIDWNAVDVVCGGNYGLEHLIGKSMGLERFDILAELFHRDFKHLLTKILRHLSAMDLINVISVSTTWRKLLQKDNWAYNAYKLGCKELCEKRAKVSSHTATRDESLCRVPLASVQKVAASSLCTSKKQSKNKNGGLSCNRLAEFIEVAQTLKNDQSLKVCVDCGSPAKHDPCLHRAICTRESCKLDFCTRCSCKYHFSKSCLMSKPGSYRIPSEPLPGSKKSKQNLRRL mint Regulates progression through early mitosis by inhibiting the anaphase promoting complex/cyclosome (APC). Binds to the APC activators cdc20 and fzr1/cdh1 to prevent APC activation. Can also bind directly to the APC to inhibit substrate-binding 06E6627033263612 plk1_xenla Serine/threonine-protein kinase PLK1 plx1 Plx1 Polo-like kinase 1 plk1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAQVAGKKLTVAPEAAKPPGIPGSSSAVKEIPEILVDPRTRRRYLRGRFLGKGGFAKCYEITDLESREVFAGKIVPKTMLLKPHQKDKMTMEIAIQRSLDHRHVVGFHGFFEDNDFVYVVLELCRRRSLLELHKRRKAVTEPEARYYLKQTISGCQYLHSNRVIHRDLKLGNLFLNDEMEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLGKKGHSFEVDIWSIGCIMYTLLVGKPPFETSCLKETYMRIKKNEYSIPKHINPVAAALIQKMLRSDPTSRPTIDDLLNDEFFTSGYIPSRLPTTCLTVPPRFSIAPSTIDQSLRKPLTAINKGQDSPLVEKQVAPAKEEEMQQPEFTEPADCYLSEMLQQLTCLNAVKPSERALIRQEEAEDPASIPIFWISKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLIMYNDGDSLQYIERNNTESYLNVRSYPTTLTKKITLLKYFRNYMSEHLLKAGANTTPREGDELARLPFLRTWFRTRSAIILHLSNGTVQINFFQDHTKIILCPLMAAVSYIDEKREFRTYKLSLIQEFGCCKELASRLRYARTMVEKLQSSKSAVAHVKASA DIP protein P70032 original sequence version: 107 DIP protein P70032 original sequence version: 61 2467195911F225E6 trcb_xenla Beta-TrCP fbxw1 btrcp Beta-transducin repeat-containing protein protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MEGFSCSLQPPTASEREDCNRDEPPRKIITEKNTLRQTKLANGTSSMIVPKQRKLSANYEKEKELCVKYFEQWSECDQVEFVEHLISRMCHYQHGHINTYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCSAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGKTPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPGLA DIP protein Q91854 original sequence version: 57 Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. May participate in Wnt signaling mint 2A52EC19028127F3 q9i9k6_xenla Peptidyl-prolyl cis-trans isomerase pin1.L Pin1 pin1 XELAEV_18018988mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MADEEKLPPGWEKRMSRSSGRVYYFNHMTNASQWERPIAGGKNGQGEPGKVRCSHLLVKHNQSRRPSSWRQDKITRSKDEALELINGYIQKMKSGDEDFESLASQFSDCSSAKAGGDLGSFGKGAMQKPFEDASFALRPGEMSGPVFTDSGIHIILRTE DIP protein Q9I9K6 original sequence version: 71 4E54F66F16C9DF1C pin1-fbxo5_a 1 emi1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Pin1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052409: original sequence: 8-37 : PPGWEKRMSRSSGRVYYFNHMTNASQWER physical association physical association F2A F2C mint pin1-fbxo5_a-1 1 emi1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate Q90Z80:p.Ser10Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S R Tue Jul 12 10:18:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:48:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser10arg' Tue Jun 30 16:08:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser10Arg' range MINT-4052435: original sequence: 10-10 : MMCGFASNQSPKKLSSKKS Pin1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B EMBO-Reports mint plk1-fbxo5_a 2 emi1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Plx1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated physical association physical association F3C mint fbxo5_a-plk1 2 emi1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated Plx1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association F3C EMBO-Reports mint fbxw1-fbxo5_a 2 beta-trcp 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level emi1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association F3D EMBO-Reports mint pin1-fbxo5_a-2 3 emi1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Pin1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F5A EMBO-Reports mint