MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Molecular dissection of the APC/C inhibitor Rca1 shows a novel F-box-dependent function. Molecular dissection of the APC/C inhibitor Rca1 shows a novel F-box-dependent function. EMBO Rep. (1469-221X) 2006 imex curation Zielke N., Querings S., Grosskortenhaus R., Reis T., Sprenger F. 2009-01-08 Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zielke N., Querings S., Grosskortenhaus R., Reis T., Sprenger F. EMBO Rep. (1469-221X) 2006 2009-01-08 Only protein-protein interactions imex curation p91666_drome Rca1 rca1 CG10800 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSAYYRRAALRKKSPSRGSSFELEMNESGYTSFLALHNSTAETPFLLEDAEGENCRNASNTTTFFRGLNTPSGHQEQDLYWGKPYPRTQPQKKFSAEEEPFSMTPRLQDEHSLPKRRKKHFQSPHSSPKKSKKLLFPHIEEPPKNRFYGGVEKLDIVAKLAQWQPALQCILRHVGAHTLDVMTKVSPAWKQAVYRSQRDLERLQNHRLKLNLTKENPHVPKRCSHVPKANHTVPLQTSNHSSLANSVRLANGLGQLEHPPDGRGCRKGAARRDACCVKCPRCGRGSRVFISEAAKCGENLLSQTLPIGRTTSTFPCMTGPPLKRFLSLDLDEVRTSPQGPPYNFAECTSVICQFRFCVNCLCKSHPGERCLVTELDTPSKLMMPRERLTPPQRAQNRDPKITRKNSLKRLCF mint 78073894EC8DF483 cul1_drome Cullin homolog 1 Cul1 Lin-19 homolog protein cul-1 lin19 CG1877 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNRSGNSQTTQKLVNLDDIWSELVEGIMQVFEHEKSLTRSQYMRFYTHVYDYCTSVSAAPSGRSSGKTGGAQLVGKKLYDRLEQFLKSYLSELLTKFKAISGEEVLLSRYTKQWKSYQFSSTVLDGICNYLNRNWVKRECEEGQKGIYKIYRLALVAWKGHLFQVLNEPVTKAVLKSIEEERQGKLINRSLVRDVIECYVELSFNEEDTDAEQQKLSVYKQNFENKFIADTSAFYEKESDAFLSTNTVTEYLKHVENRLEEETQRVRGFNSKNGLSYLHETTADVLKSTCEEVLIEKHLKIFHTEFQNLLNADRNDDLKRMYSLVALSSKNLTDLKSILENHILHQGTEAIAKCCTTDAANDPKTYVQTILDVHKKYNALVLTAFNNDNGFVAALDKACGKFINSNVVTIANSASKSPELLAKYCDLLLKKSSKNPEDKELEDNLNQVMVVFKYIEDKDVFQKYYSKMLAKRLVNHTSASDDAEAMMISKLKQTCGYEYTVKLQRMFQDIGVSKDLNSYFKQYLAEKNLTMEIDFGIEVLSSGSWPFQLSNNFLLPSELERSVRQFNEFYAARHSGRKLNWLYQMCKGELIMNVNRNNSSTYTLQASTFQMSVLLQFNDQLSFTVQQLQDNTQTQQENLIQVLQILLKAKVLTSSDNENSLTPESTVELFLDYKNKKRRININQPLKTELKVEQETVHKHIEEDRKLLIQAAIVRIMKMRKRLNHTNLISEVLNQLSTRFKPKVPVIKKCIDILIEKEYLERMEGHKDTYSYLA DIP protein Q24311 original sequence version: 94 1AF0D035DE85363C o77430_drome SkpA Dredd EG:115C2.4 skpA skpA-RC skpA-RH Dmel\CG16983 SKP1 SKPA Skp Skp1 anon-WO03040301.234 anon-WO03040301.236 anon-WO03040301.238 dSKP1 dSkp-1 dSkpA dskpA l(1)G0037 l(1)G0058 l(1)G0109 l(1)G0389 spkA Dmel_CG16983 CG16983 dSkip-1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHKDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK DIP protein O77430 original sequence version: 87 DIP protein O77430 original sequence version: 114 FD218D30AC98CA0A skpa-rca1-2 1 Rca1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain F-box range MINT-4055208: original sequence: 164-223 : QPALQCILRHVGAHTLDVMTKVSPAWKQAVYRSQRDLERLQNHRLKLNLTKENPHVPKR flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined skpA 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2A EMBO-Reports mint rca1-skpa-2 1 Rca1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain F-box range MINT-4055214: original sequence: 164-223 : QPALQCILRHVGAHTLDVMTKVSPAWKQAVYRSQRDLERLQNHRLKLNLTKENPHVPKR skpA 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B EMBO-Reports mint rca1-lin19 1 Rca1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cul1 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2C EMBO-Reports mint skpa-lin19 1 cul1 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level skpA 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2C EMBO-Reports homomint mint skpa-lin19-1 1 cul1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined skpA 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2E EMBO-Reports homomint mint rca1-lin19-1 1 Rca1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cul1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2D EMBO-Reports mint