MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Molecular mechanism of P pilus termination in uropathogenic Escherichia coli. Molecular mechanism of P pilus termination in uropathogenic Escherichia coli. EMBO Rep. (1469-221X) 2006 imex curation Verger D., Miller E., Remaut H., Waksman G., Hultgren S. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Verger D., Miller E., Remaut H., Waksman G., Hultgren S. EMBO Rep. (1469-221X) 2006 2009-01-08 Only protein-protein interactions imex curation papk_ecol6 Fimbrial adapter PapK papK papK2 c3586 c5182 protein protein ecol6 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) MIKSTGALLLFAALSAGQAIASDVAFRGNLLDRPCHVSGDSLNKHVVFKTRASRDFWYPPGRSPTESFVIRLENCHATAVGKIVTLTFKGTEEAALPGHLKVTGVNAGRLGIALLDTDGSSLLKPGTSHNKGQGEKVTGNSLELPFGAYVVATPEALRTKSVVPGDYEATATFELTYR mint Adapter that links the pilus rod to the base of the tip fibrillum. Regulates the length of the tip fibrillum and joins it to the pilus rod. Pili are polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, and enable bacteria to colonize the epithelium of specific host organs DABF3054B87CA8CB papa_ecolx Pap fimbrial major pilin protein papA protein protein ecolx Escherichia coli MIKSVIAGAVAMAVVSFGVNNAAPTIPQGQGKVTFNGTVVDAPCSISQKSADQSIDFGQLSKSFLEAGGVSKPMDLDIELVNCDITAFKGGNGAKKGTVKLAFTGPIVNGHSDELDTNGGTGTAIVVQGAGKNVVFDGSEGDANTLKDGENVLHYTAVVKKSSAVGAAVTEGAFSAVANFNLTYQ DIP protein P04127 original sequence version: 71 mint Polymerizes to form the thick (6.8 nm in diameter) rod of the pilus (also called fimbria). The rod is a right-handed helical cylinder with 3.28 papA subunits per turn. Pili are polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, and enable bacteria to colonize the epithelium of specific host organs 93DB4FFDA211C671 paph_ecolx PAP fimbrial minor pilin protein papH protein protein ecolx Escherichia coli MRLRFSVPLFFFGCVFVHGVFAGPFPPPGMSLPEYWGEEHVWWDGRAAFHGEVVRPACTLAMEDAWQIIDMGETPVRDLQNGFSGPERKFSLRLRNCEFNSQGGNLFSDSRIRVTFDGVRGETPDKFNLSGQAKGINLQIADVRGNIARAGKVMPAIPLTGNEEALDYTLRIVRNGKKLEAGNYFAVLGFRVDYE DIP protein P07111 original sequence version: 73 mint Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs PapH seems to anchor the pilus to the bacterial cell. In addition the stoichiometric relationship between papH and papA determines the pilus length D2120FC5DA063169 q47449_ecolx prsE_1 BH692_21860 ELV13_25265 ELX70_15410 ELY24_10485 FNJ67_05200 FPI65_18340 G3565_26135 G6P89_23000 HMU48_09990 NCTC9702_00981 protein protein ecolx Escherichia coli MKKIRGLCLPVILGAVLMSQHAHAADNLTFKGKLIIPACTVQNAEVNWGDIEIQKLVQSGGNQKDFTVQMTCPYHLGTMKVTISTSAATYNKGIIVKGTSSRTDDGLLIYLYNRHQNGSIGDAITLGTPFTPEHVSGQVPARNISLYAKLGYKGDIQNLRAGTFSATATLVASYS mint 8C16F90D18278FDA q4fbg4_ecolx HVV39_14280 HVW22_07655 BON93_18115 CT143_26420 D2183_28025 E0P28_26700 HIE29_005311 HMJ82_28430 HMU06_18375 papD ORF_12 D1912_32245 EPS76_26160 BK292_27740 BIQ87_16820 DTM10_26035 EWK56_04230 BON66_25855 E2112_24585 ELT58_03180 ELX79_25865 GP946_13845 EA239_22620 FPI65_18355 FZN30_23825 protein protein ecolx Escherichia coli MWKLSMIRKKILMAAIPLFVISGADAAVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKKEK mint A8E866E7D42A3C69 papd-papa 1 papA 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified papD 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F3 EMBO-Reports mint papd-paph 1 papD 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined papH 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction F3 EMBO-Reports mint papd-q47449 1 papD 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined papE 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction F3 EMBO-Reports mint papd-papk-1 1 papD 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined papK 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction F3 EMBO-Reports mint