IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The mitochondrial electron transfer flavoprotein complex is essential for survival of Arabidopsis in extended darkness. The mitochondrial electron transfer flavoprotein complex is essential for survival of Arabidopsis in extended darkness. Plant J. (0960-7412) 2006 imex curation Ishizaki K., Schauer N., Larson TR., Graham IA., Fernie AR., Leaver CJ. chris.leaver@plants.ox.ac.uk 22-Jan-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ishizaki K., Schauer N., Larson TR., Graham IA., Fernie AR., Leaver CJ. chris.leaver@plants.ox.ac.uk Accepted 2007-DEC-12 by ORCHARD. Plant J. (0960-7412) 2006 orchard Only protein-protein interactions imex curation etfa_arath Electron transfer flavoprotein subunit alpha, mitochondrial ETFA F8A12.16 At1g50940 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTRTVLLRALTKNKFVASNAPRSISISITSLSRCISTLILAEHESGTIKPQTVSTVVAANSLGESSSISLLLAGSGSSLQEAASQAASCHPSVSEVLVADSDKFEYSLAEPWAKLVDFVRQQGDYSHILASSSSFGKNILPRVAALLDVSPITDVVKILGSDQFIRPIYAGNALCTVRYTGAGPCMLTIRSTSFPVTPITANSESKKATVSQIDLSNFEDDSVSKSRYVGRSTQDTERPDLGSARVVITGGRALKSVENFKMIEKLAEKLGGAVGATRAAVDAGYVPNDLQVGQTGKIVAPELYMAFGVSGAIQHLAGIKDSKVIVAVNKDADAPIFQVADYGLVGDLFEVIPELLEKLPEKK 67B421C17450DE05 etfb_arath Electron transfer flavoprotein subunit beta, mitochondrial ETFB At5g43430 MWF20.14 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKILVAVKRVVDYAVKIRVKPDKTGVETQNVKMSMNPFCEIALEEALRIKEAGFAKEVIAVSIGPSQCVDTLRTGLAMGADRGIHVETNSIFLPLTIAKILKSLADVENPGLIFLGKQAIDDDCNQTGQMVAALLGWPQATFASKVVLDKDKNVATVDREVDGGLETLNVDLPAVITTDLRLNQPRYASLPNIMKAKSKPIKKMTVQDLKVDIKSDIEILEVTEPPKRKSGVMVSSVDELIDKLKNEAHVV 5C5B8146CA02AF7F etf_alpha-etf_beta 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association 1 Interaction of Arabidopsis ETFa and ETFb in a yeast two-hybrid experiment. ETFalpha construct lacked a putative mitochondrial targeting sequence etf_beta-etf_alpha 1 3 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association 1 Interaction of Arabidopsis ETFa and ETFb in a yeast two-hybrid experiment. ETFalpha construct lacked a putative mitochondrial targeting sequence