DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 imex curation Singh A., Mai D., Kumar A., Steyn AJ. Transformants were selected on 7H11 medium supplemented with kanamycin (KAN) and hygromycin (HYG; 7H11/KAN/HYG). Transformants were then subcultured onto 7H11KAN/HYG plates containing 50 ug/ml TRIM (7H11/TRIM) or freshly inoculated into 96-well microtiter plates containing 7H9/KAN/HYG/TRIM. A change from nonfluorescent blue to fluorescent pink color indicates reduction of the indicator Alamar Blue and allowed quantification of the assay. asteyn@uab.edu 29-OCT-2007: Contacted by JYOTI. Roland Krause, MPI, Germany Only protein-protein interactions mycsm Mycobacterium smegmatis dhfr reconstruction dihydrofolate reductase reconstruction dhfr reconstruction predetermined predetermined participant predetermined Singh A., Mai D., Kumar A., Steyn AJ. Transformants were selected on 7H11 medium supplemented with kanamycin (KAN) and hygromycin (HYG; 7H11/KAN/HYG). Transformants were then subcultured onto 7H11KAN/HYG plates containing 50 ug/ml TRIM (7H11/TRIM) or freshly inoculated into 96-well microtiter plates containing 7H9/KAN/HYG/TRIM. A change from nonfluorescent blue to fluorescent pink color indicates reduction of the indicator Alamar Blue and allowed quantification of the assay. asteyn@uab.edu Accepted 2007-JUN-23 by JYOTI. Roland Krause, MPI, Germany Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 imex curation Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 imex curation Singh A., Mai D., Kumar A., Steyn AJ. Transformants were selected on 7H11 medium supplemented with kanamycin (KAN) and hygromycin (HYG; 7H11/KAN/HYG). Transformants were then subcultured onto 7H11KAN/HYG plates containing 50 ug/ml TRIM (7H11/TRIM) or freshly inoculated into 96-well microtiter plates containing 7H9/KAN/HYG/TRIM. A change from nonfluorescent blue to fluorescent pink color indicates reduction of the indicator Alamar Blue and allowed quantification of the assay. asteyn@uab.edu 29-OCT-2007: Contacted by JYOTI. Roland Krause, MPI, Germany Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Singh A., Mai D., Kumar A., Steyn AJ. Transformants were selected on 7H11 medium supplemented with kanamycin (KAN) and hygromycin (HYG; 7H11/KAN/HYG). Transformants were then subcultured onto 7H11KAN/HYG plates containing 50 ug/ml TRIM (7H11/TRIM) or freshly inoculated into 96-well microtiter plates containing 7H9/KAN/HYG/TRIM. A change from nonfluorescent blue to fluorescent pink color indicates reduction of the indicator Alamar Blue and allowed quantification of the assay. asteyn@uab.edu Accepted 2007-JUN-23 by JYOTI. 29-OCT-2007: Contacted by JYOTI. Roland Krause, MPI, Germany Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 imex curation Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 imex curation Singh A., Mai D., Kumar A., Steyn AJ. Transformants were selected on 7H11 medium supplemented with kanamycin (KAN) and hygromycin (HYG; 7H11/KAN/HYG). Transformants were then subcultured onto 7H11KAN/HYG plates containing 50 ug/ml TRIM (7H11/TRIM) or freshly inoculated into 96-well microtiter plates containing 7H9/KAN/HYG/TRIM. A change from nonfluorescent blue to fluorescent pink color indicates reduction of the indicator Alamar Blue and allowed quantification of the assay. asteyn@uab.edu 29-OCT-2007: Contacted by JYOTI. Roland Krause, MPI, Germany Only protein-protein interactions mycsm Mycobacterium smegmatis dhfr reconstruction dihydrofolate reductase reconstruction dhfr reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Singh A., Mai D., Kumar A., Steyn AJ. Transformants were selected on 7H11 medium supplemented with kanamycin (KAN) and hygromycin (HYG; 7H11/KAN/HYG). Transformants were then subcultured onto 7H11KAN/HYG plates containing 50 ug/ml TRIM (7H11/TRIM) or freshly inoculated into 96-well microtiter plates containing 7H9/KAN/HYG/TRIM. A change from nonfluorescent blue to fluorescent pink color indicates reduction of the indicator Alamar Blue and allowed quantification of the assay. asteyn@uab.edu Accepted 2007-JUN-23 by JYOTI. 29-OCT-2007: Contacted by JYOTI. Roland Krause, MPI, Germany Mycobacterium tuberculosis H37Rv genomic DNA Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 imex curation Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 imex curation Singh A., Mai D., Kumar A., Steyn AJ. Transformants were selected on 7H11 medium supplemented with kanamycin (KAN) and hygromycin (HYG; 7H11/KAN/HYG). Transformants were then subcultured onto 7H11KAN/HYG plates containing 50 ug/ml TRIM (7H11/TRIM) or freshly inoculated into 96-well microtiter plates containing 7H9/KAN/HYG/TRIM. A change from nonfluorescent blue to fluorescent pink color indicates reduction of the indicator Alamar Blue and allowed quantification of the assay. asteyn@uab.edu 29-OCT-2007: Contacted by JYOTI. Roland Krause, MPI, Germany Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Singh A., Mai D., Kumar A., Steyn AJ. Transformants were selected on 7H11 medium supplemented with kanamycin (KAN) and hygromycin (HYG; 7H11/KAN/HYG). Transformants were then subcultured onto 7H11KAN/HYG plates containing 50 ug/ml TRIM (7H11/TRIM) or freshly inoculated into 96-well microtiter plates containing 7H9/KAN/HYG/TRIM. A change from nonfluorescent blue to fluorescent pink color indicates reduction of the indicator Alamar Blue and allowed quantification of the assay. asteyn@uab.edu Accepted 2007-JUN-23 by JYOTI. 29-OCT-2007: Contacted by JYOTI. Roland Krause, MPI, Germany Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 imex curation gcn4_yeast General control transcription factor GCN4 ARG9 GCN4 AAS3 Amino acid biosynthesis regulatory protein AAS101 General control protein GCN4 YEL009C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQDTPSNLDFDFALPQTATAPDAKTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTTSFLPTPVLEDAKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER 2ED1B8E35D509578 2ED1B8E35D509578 kdpd_myctu Sensor protein KdpD kdpD Rv1028c MTCY10G2.21 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTLLFADLCAIFTPYRWMIEHVTTKRGQLRIYLGAAPGVGKTYAMLGEAHRRLERGTDVVAAVVETHGRNKTAKLLEGIEMIPPRYVEYRGARFPELDVEAVLRRHPQVVLVDELAHTNTPGSKNPKRWQDVQEILDAGITVISTVNIQHLEGLNDVVEQITGIEQKEKIPDEIVRAADQVELVDITPEALRRRLAHGNVYAAERVDAALSNYFRTGNLTALREIALLWLADQVDAALEKYRADKKITATWEARERVVVAVTGGPESETLVRRASRIASKSSAELMVVHVIRGDGLAGVSAPQLGRVRELATSLGATMHTVVGDDVPTALLDFAREMNATQLVVGTSRRSRWARLFDEGIGARTVQEPGGIDVHMVTHPAASRASGWSRVSPRERHIASWLAALVVPSVICAITVAWLDRFMGIGGESALFFIGVLIVALLGGVAPAALSALLSGMLLNYFLTEPRYTWTIAEPDAAVTEFVLLAMAVAVAVLVDGAASRTREARRASQEAELLALFAGSVLRGADLATLLQRVRETYSQRAVTMLRVRQGASTGETVACVGTNPCRDVDSADTAIEVGDDEFWMLMAGRKLAARDRRVLTAVATQAAGLVKQRELAEEAGQAEAIARADELRRSLLSAVSHDLRTPLAAAKVAVSSLRTEDVAFSPEDTAELLATIEESIDQLTALVANLLDSSRLAAGVIRPQLRRAYLEEAVQRALVSIGKGATGFYRSGIDRVKVDVGDAVAMADAGLLERVLANLIDNALRYAPDCVVRVNAGRVRERVLINVIDEGPGVPRGTEEQLFAPFQRPGDHDNTTGVGLGMSVARGFVEAMGGTISATDTPGGGLTVVIDLAAPEDRP 0494DA140A6B04C2 devs_myctu Oxygen sensor histidine kinase response regulator DevS/DosS devS dosS Rv3132c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTTGGLVDENDGAAMRPLRHTLSQLRLHELLVEVQDRVEQIVEGRDRLDGLVEAMLVVTAGLDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARLYQQAKARQSWIEATRDIATELLSGTEPATVFRLVAAEALKLTAADAALVAVPVDEDMPAADVGELLVIETVGSAVASIVGRTIPVAGAVLREVFVNGIPRRVDRVDLEGLDELADAGPALLLPLRARGTVAGVVVVLSQGGPGAFTDEQLEMMAAFADQAALAWQLATSQRRMRELDVLTDRDRIARDLHDHVIQRLFAIGLALQGAVPHERNPEVQQRLSDVVDDLQDVIQEIRTTIYDLHGASQGITRLRQRIDAAVAQFADSGLRTSVQFVGPLSVVDSALADQAEAVVREAVSNAVRHAKASTLTVRVKVDDDLCIEVTDNGRGLPDEFTGSGLTNLRQRAEQAGGEFTLASVPGASGTVLRWSAPLSQ 4C04B836791B9B32 clpc1_myctu ATP-dependent Clp protease ATP-binding subunit ClpC1 clpC1 MTCY07H7B.26 Rv3596c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGGESGSPSTSLVLDQFGRNLTAAAMEGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRFQPVQVGEPTVEHTIEILKGLRDRYEAHHRVSITDAAMVAAATLADRYINDRFLPDKAIDLIDEAGARMRIRRMTAPPDLREFDEKIAEARREKESAIDAQDFEKAASLRDREKTLVAQRAEREKQWRSGDLDVVAEVDDEQIAEVLGNWTGIPVFKLTEAETTRLLRMEEELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTSDISKPVGLGFSKGGGENDYERMKQKVNDELKKHFRPEFLNRIDDIIVFHQLTREEIIRMVDLMISRVAGQLKSKDMALVLTDAAKALLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFEEVGPGQVVTVDVDNWDGEGPGEDAVFTFTGTRKPPAEPDLAKAGAHSAGGPEPAAR 4D536FBDA183CD94 p95032_mycto MT0714 protein protein mycto Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) MLARYIKMQLLVLLCGGLVGPIFLVVYFTLGLGSLMSWMFYVGLIITVADVLVALALTNYGAKTAAKTAALERSGVLALAQITGLSETGTRINDQPLVKVHLHISGPGITPFDTEDRVIASVTRLGNLTARKLVVLVNPATQQYLIDWERSALVNGLVPAQFTVAEDNKTYDLSGQTGPLMEILQILKANNVPLNRMVDIRSNPALRQQVQAVVRRAAERQAPAAEPASQGSIAERLAELESLRASGAVNAAEYESKRAQIISEI 7E96AFD7EC608067 devr_myctu DNA-binding transcriptional activator DevR/DosR devR dosR Rv3133c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKRSRPPGDGP 1BA535C26CC4EB51 esxb_myctu ESAT-6-like protein EsxB esxB cfp10 lhp mtsA10 Rv3874 MTV027.09 10 kDa culture filtrate antigen CFP-10 Secreted antigenic protein MTSA-10 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF DIP protein P9WNK5 original sequence version: 8 DIP protein P9WNK5 original sequence version: 10 285F4FC96F55D194 i6xvz6_myctu Rv0686 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MLARYIKMQLLVLLCGGLVGPIFLVVYFTLGLGSLMSWMFYVGLIITVADVLVALALTNYGAKTAAKTAALERSGVLALAQITGLSETGTRINDQPLVKVHLHISGPGITPFDTEDRVIASVTRLGNLTARKLVVLVNPATQQYLIDWERSALVNGLVPAQFTVAEDNKTYDLSGQTGPLMEILQILKANNVPLNRMVDIRSNPALRQQVQAVVRRAAERQAPAAEPASQGSIAERLAELESLRASGAVNAAEYESKRAQIISEI 7E96AFD7EC608067 ftsq_myctu Cell division protein FtsQ ftsQ Rv2151c MTCY270.17 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTEHNEDPQIERVADDAADEEAVTEPLATESKDEPAEHPEFEGPRRRARRERAERRAAQARATAIEQARRAAKRRARGQIVSEQNPAKPAARGVVRGLKALLATVVLAVVGIGLGLALYFTPAMSAREIVIIGIGAVSREEVLDAARVRPATPLLQIDTQQVADRVATIRRVASARVQRQYPSALRITIVERVPVVVKDFSDGPHLFDRDGVDFATDPPPPALPYFDVDNPGPSDPTTKAALQVLTALHPEVASQVGRIAAPSVASITLTLADGRVVIWGTTDRCEEKAEKLAALLTQPGRTYDVSSPDLPTVK FD8C00B41A329D60 kdpe_myctu Transcriptional regulatory protein KdpE kdpE Rv1027c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTLVLVIDDEPQILRALRINLTVRGYQVITASTGAGALRAAAEHPPDVVILDLGLPDMSGIDVLGGLRGWLTAPVIVLSARTDSSDKVQALDAGADDYVTKPFGMDEFLARLRAAVRRNTAAAELEQPVIETDSFTVDLAGKKVIKDGAEVHLTPTEWGMLEMLARNRGKLVGRGELLKEVWGPAYATETHYLRVYLAQLRRKLEDDPSHPKHLLTESGMGYRFEA 68BE8DDC38AED423 clpp2_myctu ATP-dependent Clp protease proteolytic subunit 2 clpP2 Rv2460c MTV008.16c Endopeptidase Clp 2 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MNSQNSQIQPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDASANDIMAQLLVLESLDPDRDITMYINSPGGGFTSLMAIYDTMQYVRADIQTVCLGQAASAAAVLLAAGTPGKRMALPNARVLIHQPSLSGVIQGQFSDLEIQAAEIERMRTLMETTLARHTGKDAGVIRKDTDRDKILTAEEAKDYGIIDTVLEYRKLSAQTA 4B26A854F0F984AB esxa_myctu 6 kDa early secretory antigenic target esxA esaT6 Rv3875 MTV027.10 ESAT-6 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA DIP protein P9WNK7 original sequence version: 8 DIP protein P9WNK7 original sequence version: 10 79BD529E3D88F519 y2240_myctu Uncharacterized protein Rv2240c Rv2240c MTCY427.21c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MLIGWRAVPRRHGGELPRRGALALGCIALLLMGIVGCTTVTDGTAMPDTNVAPAYRSSVSASVSASAATSSIRESQRQQSLTTKAIRTSCDALAATSKDAIDKVNAYVAAFNQGRNTGPTEGPAIDALNNSASTVSGSLSAALSAQLGDALNAYVDAARAVANAIGAHASTAEFNRRVDRLNDTKTKALTMCVAAF D5C7E64578BEEC0B pks13_myctu Polyketide synthase Pks13 pks13 Rv3800c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MADVAESQENAPAERAELTVPEMRQWLRNWVGKAVGKAPDSIDESVPMVELGLSSRDAVAMAADIEDLTGVTLSVAVAFAHPTIESLATRIIEGEPETDLAGDDAEDWSRTGPAERVDIAIVGLSTRFPGEMNTPEQTWQALLEGRDGITDLPDGRWSEFLEEPRLAARVAGARTRGGYLKDIKGFDSEFFAVAKTEADNIDPQQRMALELTWEALEHARIPASSLRGQAVGVYIGSSTNDYSFLAVSDPTVAHPYAITGTSSSIIANRVSYFYDFHGPSVTIDTACSSSLVAIHQGVQALRNGEADVVVAGGVNALITPMVTLGFDEIGAVLAPDGRIKSFSADADGYTRSEGGGMLVLKRVDDARRDGDAILAVIAGSAVNHDGRSNGLIAPNQDAQADVLRRAYKDAGIDPRTVDYIEAHGTGTILGDPIEAEALGRVVGRGRPADRPALLGAVKTNVGHLESAAGAASMAKVVLALQHDKLPPSINFAGPSPYIDFDAMRLKMITTPTDWPRYGGYALAGVSSFGFGGANAHVVVREVLPRDVVEKEPEPEPEPKAAAEPAEAPTLAGHALRFDEFGNIITDSAVAEEPEPELPGVTEEALRLKEAALEELAAQEVTAPLVPLAVSAFLTSRKKAAAAELADWMQSPEGQASSLESIGRSLSRRNHGRSRAVVLAHDHDEAIKGLRAVAAGKQAPNVFSVDGPVTTGPVWVLAGFGAQHRKMGKSLYLRNEVFAAWIEKVDALVQDELGYSVLELILDDAQDYGIETTQVTIFAIQIALGELLRHHGAKPAAVIGQSLGEAASAYFAGGLSLRDATRAICSRSHLMGEGEAMLFGEYIRLMALVEYSADEIREVFSDFPDLEVCVYAAPTQTVIGGPPEQVDAILARAEAEGKFARKFATKGASHTSQMDPLLGELTAELQGIKPTSPTCGIFSTVHEGRYIKPGGEPIHDVEYWKKGLRHSVYFTHGIRNAVDSGHTTFLELAPNPVALMQVALTTADAGLHDAQLIPTLARKQDEVSSMVSTMAQLYVYGHDLDIRTLFSRASGPQDYANIPPTRFKRKEHWLPAHFSGDGSTYMPGTHVALPDGRHVWEYAPRDGNVDLAALVRAAAAHVLPDAQLTAAEQRAVPGDGARLVTTMTRHPGGASVQVHARIDESFTLVYDALVSRAGSESVLPTAVGAATAIAVADGAPVAPETPAEDADAETLSDSLTTRYMPSGMTRWSPDSGETIAERLGLIVGSAMGYEPEDLPWEVPLIELGLDSLMAVRIKNRVEYDFDLPPIQLTAVRDANLYNVEKLIEYAVEHRDEVQQLHEHQKTQTAEEIARAQAELLHGKVGKTEPVDSEAGVALPSPQNGEQPNPTGPALNVDVPPRDAAERVTFATWAIVTGKSPGGIFNELPRLDDEAAAKIAQRLSERAEGPITAEDVLTSSNIEALADKVRTYLEAGQIDGFVRTLRARPEAGGKVPVFVFHPAGGSTVVYEPLLGRLPADTPMYGFERVEGSIEERAQQYVPKLIEMQGDGPYVLVGWSLGGVLAYACAIGLRRLGKDVRFVGLIDAVRAGEEIPQTKEEIRKRWDRYAAFAEKTFNVTIPAIPYEQLEELDDEGQVRFVLDAVSQSGVQIPAGIIEHQRTSYLDNRAIDTAQIQPYDGHVTLYMADRYHDDAIMFEPRYAVRQPDGGWGEYVSDLEVVPIGGEHIQAIDEPIIAKVGEHMSRALGQIEADRTSEVGKQ D6D933468481E86A gcn4-gcn4-1 1 5 unspecified role unspecified role bait bait c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association We generated these bait and prey plasmids as C-terminal fusions with the complementary fragments of mDHFR to generate the interacting protein pairs GCN4[F1,2]/GCN4[F3], KdpD[F1,2]/KdpE[F3], and Esat-6[F1,2]/Cfp-10[F3]. Fig. 3, 5 kdpe-kdpd-1 1 6 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association We generated these bait and prey plasmids as C-terminal fusions with the complementary fragments of mDHFR to generate the interacting protein pairs GCN4[F1,2]/GCN4[F3], KdpD[F1,2]/KdpE[F3], and Esat-6[F1,2]/Cfp-10[F3]. Fig. 3 esxa-esxb-1 1 16 unspecified role unspecified role bait bait c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association We generated these bait and prey plasmids as C-terminal fusions with the complementary fragments of mDHFR to generate the interacting protein pairs GCN4[F1,2]/GCN4[F3], KdpD[F1,2]/KdpE[F3], and Esat-6[F1,2]/Cfp-10[F3]. Fig. 3, 4B, 5 esxa-esxb-2 1 16 unspecified role unspecified role bait bait n-terminal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey n-terminal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fusion of F[1,2] and F[3] to the N or C Terminus of Esat-6 and Cfp-10 Does Not Significantly Influence Association. Fig. 4B devs-devr-1 1 10 unspecified role unspecified role prey prey c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role bait bait c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association To assess whether M-PFC is capable of detecting interactions between Mtb cytosolic and membrane signaling proteins, we studied the interaction between the Mtb membrane-spanning sensor histidine kinase, DevS (Rv3132c), and its corresponding response regulator DevR (Rv3133c; Fig. 4A). Fig. 4B, 5 esxa-esxb-3 3 11 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association Cfp-10-interacting Mtb proteins identified in an M-PFC screen Table 1 rv0686-esxb-1 3 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Cfp-10-interacting Mtb proteins identified in an M-PFC screen Table 1 ftsq-esxb-1 3 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Cfp-10-interacting Mtb proteins identified in an M-PFC screen Table 1 clpc-esxb-2 3 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Cfp-10-interacting Mtb proteins identified in an M-PFC screen Table 1 pks13-esxb-1 3 11 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Cfp-10-interacting Mtb proteins identified in an M-PFC screen Table 1 rv2240c-esxb-1 3 11 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Cfp-10-interacting Mtb proteins identified in an M-PFC screen Table 1 clpc-esxb-3 4 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association we used the Y2H system and in vivo pull-down assays to: (i) independently verify the Cfp-10/ClpC1, Cfp-10/Pks13, Cfp-10/FtsQ Cfp-10/Rv2240c, and Cfp-10/Rv0686 interactions Sup. Fig. 7 rv0686-esxb-2 4 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association we used the Y2H system and in vivo pull-down assays to: (i) independently verify the Cfp-10/ClpC1, Cfp-10/Pks13, Cfp-10/FtsQ Cfp-10/Rv2240c, and Cfp-10/Rv0686 interactions Sup. Fig. 7 ftsq-esxb-2 4 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association we used the Y2H system and in vivo pull-down assays to: (i) independently verify the Cfp-10/ClpC1, Cfp-10/Pks13, Cfp-10/FtsQ Cfp-10/Rv2240c, and Cfp-10/Rv0686 interactions Fig 7 rv2240c-esxb-2 4 17 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association we used the Y2H system and in vivo pull-down assays to: (i) independently verify the Cfp-10/ClpC1, Cfp-10/Pks13, Cfp-10/FtsQ Cfp-10/Rv2240c, and Cfp-10/Rv0686 interactions Sup Fig 7 clpc-esxb-4 2 8 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey physical association physical association we used the Y2H system and in vivo pull-down assays to: (i) independently verify the Cfp-10/ClpC1, Cfp-10/Pks13, Cfp-10/FtsQ Cfp-10/Rv2240c, and Cfp-10/Rv0686 interactions Sup. Fig. 8 clpc-esxa-1 2 8 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 16 unspecified role unspecified role prey prey physical association physical association we used the Y2H system and in vivo pull-down assays to: (i) independently verify the Cfp-10/ClpC1, Cfp-10/Pks13, Cfp-10/FtsQ Cfp-10/Rv2240c, and Cfp-10/Rv0686 interactions Sup. Fig. 8 clpc-clpp2-1 2 8 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey physical association physical association we used the Y2H system and in vivo pull-down assays to: (i) independently verify the Cfp-10/ClpC1, Cfp-10/Pks13, Cfp-10/FtsQ Cfp-10/Rv2240c, and Cfp-10/Rv0686 interactions Sup. Fig. 8