UniProt UniProt http://www.uniprot.org Interaction between PCNA and diubiquitinated Mcm10 is essential for cell growth in budding yeast. Interaction between PCNA and diubiquitinated Mcm10 is essential for cell growth in budding yeast. Mol. Cell. Biol. (0270-7306) 2006 imex curation Das-Bradoo S., Ricke RM., Bielinsky AK. please chech histine interaction hht1-; it's a histone association assay for chromatin-binding. include here ??? Cells expressing MCM10-myc and HHT1/2-HA have been used. bieli003@umn.edu davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Das-Bradoo S., Ricke RM., Bielinsky AK. please chech histine interaction hht1-; it's a histone association assay for chromatin-binding. include here ??? Cells expressing MCM10-myc and HHT1/2-HA have been used. bieli003@umn.edu Accepted 2007-OCT-20 by DAVET. Mol. Cell. Biol. (0270-7306) 2006 davet Only protein-protein interactions imex curation Interaction between PCNA and diubiquitinated Mcm10 is essential for cell growth in budding yeast. Interaction between PCNA and diubiquitinated Mcm10 is essential for cell growth in budding yeast. Mol. Cell. Biol. (0270-7306) 2006 imex curation Das-Bradoo S., Ricke RM., Bielinsky AK. please chech histine interaction hht1-; it's a histone association assay for chromatin-binding. include here ??? Cells expressing MCM10-myc and HHT1/2-HA have been used. bieli003@umn.edu davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip antibody detection identification by antibody antibody detection Das-Bradoo S., Ricke RM., Bielinsky AK. please chech histine interaction hht1-; it's a histone association assay for chromatin-binding. include here ??? Cells expressing MCM10-myc and HHT1/2-HA have been used. bieli003@umn.edu Accepted 2007-OCT-20 by DAVET. Mol. Cell. Biol. (0270-7306) 2006 davet Only protein-protein interactions imex curation Interaction between PCNA and diubiquitinated Mcm10 is essential for cell growth in budding yeast. Interaction between PCNA and diubiquitinated Mcm10 is essential for cell growth in budding yeast. Mol. Cell. Biol. (0270-7306) 2006 imex curation Das-Bradoo S., Ricke RM., Bielinsky AK. please chech histine interaction hht1-; it's a histone association assay for chromatin-binding. include here ??? Cells expressing MCM10-myc and HHT1/2-HA have been used. bieli003@umn.edu davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Das-Bradoo S., Ricke RM., Bielinsky AK. please chech histine interaction hht1-; it's a histone association assay for chromatin-binding. include here ??? Cells expressing MCM10-myc and HHT1/2-HA have been used. bieli003@umn.edu Accepted 2007-OCT-20 by DAVET. Mol. Cell. Biol. (0270-7306) 2006 davet Only protein-protein interactions imex curation Interaction between PCNA and diubiquitinated Mcm10 is essential for cell growth in budding yeast. Interaction between PCNA and diubiquitinated Mcm10 is essential for cell growth in budding yeast. Mol. Cell. Biol. (0270-7306) 2006 imex curation Das-Bradoo S., Ricke RM., Bielinsky AK. please chech histine interaction hht1-; it's a histone association assay for chromatin-binding. include here ??? Cells expressing MCM10-myc and HHT1/2-HA have been used. bieli003@umn.edu davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Das-Bradoo S., Ricke RM., Bielinsky AK. please chech histine interaction hht1-; it's a histone association assay for chromatin-binding. include here ??? Cells expressing MCM10-myc and HHT1/2-HA have been used. bieli003@umn.edu Accepted 2007-OCT-20 by DAVET. Mol. Cell. Biol. (0270-7306) 2006 davet Only protein-protein interactions imex curation h3_yeast Histone H3 SIN2 YNL031C N2749 HHT1 YBR010W YBR0201 HHT2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS A6115FEB480AC67A A6115FEB480AC67A mcm10_yeast Minichromosome maintenance protein 10 YIL150C MCM10 DNA43 Protein DNA43 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPTKVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKETKETSDGSASDLEII D32CFF4A94FD9B2A pcna_yeast Proliferating cell nuclear antigen YBR0811 YBR088C POL30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE 9B56C5851621DDDC 9B56C5851621DDDC dpod3_yeast DNA polymerase delta subunit 3 POL32 J1626 YJR043C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDQKASYFINEKLFTEVKPVLFTDLIHHLKIGPSMAKKLMFDYYKQTTNAKYNCVVICCYKDQTIKIIHDLSNIPQQDSIIDCFIYAFNPMDSFIPYYDIIDQKDCLTIKNSYELKVSESSKIIERTKTLEEKSKPLVRPTARSKTTPEETTGRKSKSKDMGLRSTALLAKMKKDRDDKETSRQNELRKRKEENLQKINKQNPEREAQMKELNNLFVEDDLDTEEVNGGSKPNSPKETDSNDKDKNNDDLEDLLETTAEDSLMDVPKIQQTKPSETEHSKEPKSEEEPSSFIDEDGYIVTKRPATSTPPRKPSPVVKRALSSSKKQETPSSNKRLKKQGTLESFFKRKAK D0B9CC52F26E20B2 D0B9CC52F26E20B2 dpoa_yeast DNA polymerase alpha catalytic subunit A POL1 CDC17 DNA polymerase alpha:primase complex p180 subunit DNA polymerase I subunit A N2181 YNL102W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSKSEKLEKLRKLQAARNGTSIDDYEGDESDGDRIYDEIDEKEYRARKRQELLHDDFVVDDDGVGYVDRGVEEDWREVDNSSSDEDTGNLASKDSKRKKNIKREKDHQITDMLRTQHSKSTLLAHAKKSQKKSIPIDNFDDILGEFESGEVEKPNILLPSKLRENLNSSPTSEFKSSIKRVNGNDESSHDAGISKKVKIDPDSSTDKYLEIESSPLKLQSRKLRYANDVQDLLDDVENSPVVATKRQNVLQDTLLANPPSAQSLADEEDDEDSDEDIILKRRTMRSVTTTRRVNIDSRSNPSTSPFVTAPGTPIGIKGLTPSKSLQSNTDVATLAVNVKKEDVVDPETDTFQMFWLDYCEVNNTLILFGKVKLKDDNCVSAMVQINGLCRELFFLPREGKTPTDIHEEIIPLLMDKYGLDNIRAKPQKMKYSFELPDIPSESDYLKVLLPYQTPKSSRDTIPSDLSSDTFYHVFGGNSNIFESFVIQNRIMGPCWLDIKGADFNSIRNASHCAVEVSVDKPQNITPTTTKTMPNLRCLSLSIQTLMNPKENKQEIVSITLSAYRNISLDSPIPENIKPDDLCTLVRPPQSTSFPLGLAALAKQKLPGRVRLFNNEKAMLSCFCAMLKVEDPDVIIGHRLQNVYLDVLAHRMHDLNIPTFSSIGRRLRRTWPEKFGRGNSNMNHFFISDICSGRLICDIANEMGQSLTPKCQSWDLSEMYQVTCEKEHKPLDIDYQNPQYQNDVNSMTMALQENITNCMISAEVSYRIQLLTLTKQLTNLAGNAWAQTLGGTRAGRNEYILLHEFSRNGFIVPDKEGNRSRAQKQRQNEENADAPVNSKKAKYQGGLVFEPEKGLHKNYVLVMDFNSLYPSIIQEFNICFTTVDRNKEDIDELPSVPPSEVDQGVLPRLLANLVDRRREVKKVMKTETDPHKRVQCDIRQQALKLTANSMYGCLGYVNSRFYAKPLAMLVTNKGREILMNTRQLAESMNLLVVYGDTDSVMIDTGCDNYADAIKIGLGFKRLVNERYRLLEIDIDNVFKKLLLHAKKKYAALTVNLDKNGNGTTVLEVKGLDMKRREFCPLSRDVSIHVLNTILSDKDPEEALQEVYDYLEDIRIKVETNNIRIDKYKINMKLSKDPKAYPGGKNMPAVQVALRMRKAGRVVKAGSVITFVITKQDEIDNAADTPALSVAERAHALNEVMIKSNNLIPDPQYYLEKQIFAPVERLLERIDSFNVVRLSEALGLDSKKYFRREGGNNNGEDINNLQPLETTITDVERFKDTVTLELSCPSCDKRFPFGGIVSSNYYRVSYNGLQCKHCEQLFTPLQLTSQIEHSIRAHISLYYAGWLQCDDSTCGIVTRQVSVFGKRCLNDGCTGVMRYKYSDKQLYNQLLYFDSLFDCEKNKKQELKPIYLPDDLDYPKEQLTESSIKALTEQNRELMETGRSVVQKYLNDCGRRYVDMTSIFDFMLN 50C9032DBE95B5AE 50C9032DBE95B5AE pol30-mcm10-1 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2 Only a modified form of MCM10 (82 kDa) has been detected. pol30-mcm10-2 2 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1b pol1-mcm10-1 2 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1b Only an unmodified form of MCM10 (66 kDa) has been detected. hht1-mcm10-1 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Histine H3 antibody was used to immunoprecipiate bulk chromatin. Unmodified and ubquitinated forms of MCM10 have been detected and both forms cycle on and off chromatin. 6a mcm10-pol30-1 4 7 unspecified role unspecified role prey prey P15873:p.Ala251Val mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain A V Wed May 02 14:53:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala251val' Tue Jun 30 17:45:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala251Val' P15873:p.Tyr133Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:43:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr133ala' Tue Jun 30 19:52:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr133Ala' 6 unspecified role unspecified role bait bait P32354:p.Leu242Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:42:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu242ala' Tue Jun 30 18:44:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu242Ala' P32354:p.Tyr245Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:20:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr245ala' Tue Jun 30 18:06:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr245Ala' P32354:p.Leu242Tyr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L Y Wed May 02 17:32:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu242tyr' Tue Jun 30 20:08:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu242Tyr' physical association physical association 7c and d pol32-pol30-1 4 7 unspecified role unspecified role prey prey P15873:p.Ala251Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A V Wed May 02 20:33:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala251val' Tue Jun 30 16:51:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala251Val' P15873:p.Tyr133Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:22:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr133ala' Tue Jun 30 19:22:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr133Ala' P15873:p.Tyr133Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y L Wed May 02 17:28:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr133leu' Tue Jun 30 19:55:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr133Leu' 8 unspecified role unspecified role bait bait physical association physical association 7c and d cdc20-mcm10-2 3 7 unspecified role unspecified role bait bait region required xlnk-n6lys-1gly N6-glycyl-L-lysine (2S)-2-amino-6-[(aminoacetyl)amino]hexanoic acid N6-(glycyl)-L-lysine N6-glycyllysine XLNK-N6Lys-1Gly CROSSLNK Glycyl lysine isopeptide (Gly-Lys) (interchain with K-...) CROSSLNK Glycyl lysine isopeptide (Lys-Gly) (interchain with G-...) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 9