IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. Cell Res. (1001-0602) 2006 imex curation Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Adult human brain cDNA Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Accepted 2007-APR-7 by JYOTI. Cell Res. (1001-0602) 2006 Only protein-protein interactions imex curation A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. Cell Res. (1001-0602) 2006 imex curation Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Adult human brain cDNA Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Accepted 2007-APR-7 by JYOTI. Cell Res. (1001-0602) 2006 Only protein-protein interactions imex curation A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. Cell Res. (1001-0602) 2006 imex curation Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Adult human brain cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Accepted 2007-APR-7 by JYOTI. Cell Res. (1001-0602) 2006 Only protein-protein interactions imex curation A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. Cell Res. (1001-0602) 2006 imex curation Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Adult human brain cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Accepted 2007-APR-7 by JYOTI. Adult human brain cDNA Cell Res. (1001-0602) 2006 Only protein-protein interactions imex curation A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins. Cell Res. (1001-0602) 2006 imex curation Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Adult human brain cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gao Y., Jiang M., Yang T., Ni J., Chen J. Synapse - Interactions of proteins with an established role in the presynapse. jychen@sunm.shcnc.ac.en Accepted 2007-APR-7 by JYOTI. Cell Res. (1001-0602) 2006 Only protein-protein interactions imex curation 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein Q04917 original sequence version: 166 DIP protein Q04917 original sequence version: 168 DIP protein Q04917 original sequence version: 175 D70FBC100C45D6E5 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN DIP protein P27348 original sequence version: 164 DIP protein P27348 original sequence version: 173 175534325E9E37C4 cdk14_human Cyclin-dependent kinase 14 CDK14 KIAA0834 PFTK1 Serine/threonine-protein kinase PFTAIRE-1 Cell division protein kinase 14 protein protein human Homo sapiens Human MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH 32CF9B9B7BD9CE0E pftk1-ywhab-1 4 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association In this study, we screened hPFTAIRE1 interacting proteins in two hybrid system and identified four 14-3-3 isoforms (beta, epsilon, eta, tau). pftk1-ywhae-1 4 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association In this study, we screened hPFTAIRE1 interacting proteins in two hybrid system and identified four 14-3-3 isoforms (beta, epsilon, eta, tau). pftk1-ywhah-1 4 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association In this study, we screened hPFTAIRE1 interacting proteins in two hybrid system and identified four 14-3-3 isoforms (beta, epsilon, eta, tau). pftk1-ywhaq-1 4 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association In this study, we screened hPFTAIRE1 interacting proteins in two hybrid system and identified four 14-3-3 isoforms (beta, epsilon, eta, tau). pftk1-ywhab-2 5 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait O94921:p.Ser119Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:26:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser119ala' Tue Jun 30 18:28:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser119Ala' region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association The interactions between hPFTAIRE1 and the four 14-3-3 isoforms were verified by two hybrid analysis. Fig 1A, 1B, 3A, 4A pftk1-ywhae-2 5 10 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O94921:p.Ser119Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:31:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser119ala' Tue Jun 30 17:28:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser119Ala' 6 unspecified role unspecified role prey prey physical association physical association The interactions between hPFTAIRE1 and the four 14-3-3 isoforms were verified by two hybrid analysis. 1A, 1B, 3A, 4A pftk1-ywhah-2 5 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait O94921:p.Ser119Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:23:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser119ala' Tue Jun 30 16:06:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser119Ala' region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association The interactions between hPFTAIRE1 and the four 14-3-3 isoforms were verified by two hybrid analysis. 1A, 1B, 3A, 4A pftk1-ywhaq-2 5 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O94921:p.Ser119Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:15:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser119ala' Tue Jun 30 16:32:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser119Ala' physical association physical association The interactions between hPFTAIRE1 and the four 14-3-3 isoforms were verified by two hybrid analysis. 1A, 1B, 3A, 4A pftk1-ywhab-3 3 8 unspecified role unspecified role prey prey region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait lexa tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The physical interactions between the hPFTAIRE1 and the four 14-3-3 isoforms were confirmed by coimmnoprecipitation in yeast cells. 1C pftk1-ywhae-3 3 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait lexa tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The physical interactions between the hPFTAIRE1 and the four 14-3-3 isoforms were confirmed by coimmnoprecipitation in yeast cells. 1C pftk1-ywhah-3 3 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait lexa tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The physical interactions between the hPFTAIRE1 and the four 14-3-3 isoforms were confirmed by coimmnoprecipitation in yeast cells. 1C pftk1-ywhaq-3 3 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey lexa tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The physical interactions between the hPFTAIRE1 and the four 14-3-3 isoforms were confirmed by coimmnoprecipitation in yeast cells. 1C pftk1-ywhab-4 2 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Interaction of hPFTAIRE1 with 14-3-3 proteins in HeLa cells 1D pftk1-ywhab-5 1 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Interaction of hPFTAIRE1 with 14-3-3 proteins in HeLa cells 3C