IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ HCCR-1-interacting molecule "deleted in polyposis 1" plays a tumor-suppressor role in colon carcinogenesis. HCCR-1-interacting molecule "deleted in polyposis 1" plays a tumor-suppressor role in colon carcinogenesis. Gastroenterology (0016-5085) 2006 Shin SM., Chung YJ., Oh ST., Jeon HM., Hwang LJ., Namkoong H., Kim HK., Cho GW., Hur SY., Kim TE., Lee YS., Park YG., Ko J., Kim JW. Cancer - Interactions investigated in the context of cancer jinwoo@catholic.ac.kr 22-Jan-2008: Contacted by JYOTI. A human fetal brain MATCHMAKER cDNA library was used. DAVET in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Shin SM., Chung YJ., Oh ST., Jeon HM., Hwang LJ., Namkoong H., Kim HK., Cho GW., Hur SY., Kim TE., Lee YS., Park YG., Ko J., Kim JW. Cancer - Interactions investigated in the context of cancer jinwoo@catholic.ac.kr Accepted 2007-DEC-21 by DAVET. 22-Jan-2008: Contacted by JYOTI. A human fetal brain MATCHMAKER cDNA library was used. Gastroenterology (0016-5085) 2006 DAVET HCCR-1-interacting molecule "deleted in polyposis 1" plays a tumor-suppressor role in colon carcinogenesis. HCCR-1-interacting molecule "deleted in polyposis 1" plays a tumor-suppressor role in colon carcinogenesis. Gastroenterology (0016-5085) 2006 Shin SM., Chung YJ., Oh ST., Jeon HM., Hwang LJ., Namkoong H., Kim HK., Cho GW., Hur SY., Kim TE., Lee YS., Park YG., Ko J., Kim JW. Cancer - Interactions investigated in the context of cancer jinwoo@catholic.ac.kr 22-Jan-2008: Contacted by JYOTI. A human fetal brain MATCHMAKER cDNA library was used. DAVET human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shin SM., Chung YJ., Oh ST., Jeon HM., Hwang LJ., Namkoong H., Kim HK., Cho GW., Hur SY., Kim TE., Lee YS., Park YG., Ko J., Kim JW. Cancer - Interactions investigated in the context of cancer jinwoo@catholic.ac.kr Accepted 2007-DEC-21 by DAVET. 22-Jan-2008: Contacted by JYOTI. A human fetal brain MATCHMAKER cDNA library was used. Gastroenterology (0016-5085) 2006 DAVET HCCR-1-interacting molecule "deleted in polyposis 1" plays a tumor-suppressor role in colon carcinogenesis. HCCR-1-interacting molecule "deleted in polyposis 1" plays a tumor-suppressor role in colon carcinogenesis. Gastroenterology (0016-5085) 2006 Shin SM., Chung YJ., Oh ST., Jeon HM., Hwang LJ., Namkoong H., Kim HK., Cho GW., Hur SY., Kim TE., Lee YS., Park YG., Ko J., Kim JW. Cancer - Interactions investigated in the context of cancer jinwoo@catholic.ac.kr 22-Jan-2008: Contacted by JYOTI. A human fetal brain MATCHMAKER cDNA library was used. DAVET yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Shin SM., Chung YJ., Oh ST., Jeon HM., Hwang LJ., Namkoong H., Kim HK., Cho GW., Hur SY., Kim TE., Lee YS., Park YG., Ko J., Kim JW. Cancer - Interactions investigated in the context of cancer jinwoo@catholic.ac.kr Accepted 2007-DEC-21 by DAVET. A human fetal brain MATCHMAKER cDNA library was used. Gastroenterology (0016-5085) 2006 DAVET reep5_human Receptor expression-enhancing protein 5 REEP5 C5orf18 DP1 TB2 Polyposis locus protein 1 Protein TB2 protein protein human Homo sapiens Human MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST F4E57E500CB7C831 ltmd1_human LETM1 domain-containing protein 1 LETMD1 Cervical cancer 1 proto-oncogene protein p40 Cervical cancer proto-oncogene 2 protein HCRR-2 HCCR-1 protein protein human Homo sapiens Human MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQFRQDVTKCLFLGIISIPPFANYLVFLLMYLFPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQALHVKALSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVLLSTNYLGTRR EC50BEFB0E4A6DF5 q9by59-reep5 3 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association BAIT gene AF195651; PREY gene NM_005669 we performed a yeast 2-hybrid screen and identified the DP1 protein,6-8 encoded by the gene C5orf18 (GenBank accession number NM_005669), was interacted with HCCR-1. reep5-q9by59 1 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association BAIT gene NM_005669; PREY gene AF195651 1 A The interaction of HCCR-1 and DP1 identified by the yeast 2-hybrid screen was confirmed by GST pull-down experiments reep5-q9by59-1 2 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1 B we made DP1-Myc fusion protein and incubated the fusion protein with protein extracts from HEK 293 cells transfected with HCCR-1 fused to a V5 (Invitrogen). HCCR-1 protein specifically coprecipitated with DP1