IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity. Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity. Plant Physiol. (0032-0889) 2005 imex curation Choi HI., Park HJ., Park JH., Kim S., Im MY., Seo HH., Kim YW., Hwang I., Kim SY. sooykim@kkpc.com 13-Nov-2007: Contacted by JYOTI. ABA/salt-treated Arabidopsis seedling cDNA library orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Choi HI., Park HJ., Park JH., Kim S., Im MY., Seo HH., Kim YW., Hwang I., Kim SY. sooykim@kkpc.com Accepted 2007-NOV-3 by ORCHARD. ABA/salt-treated Arabidopsis seedling cDNA library Plant Physiol. (0032-0889) 2005 orchard Only protein-protein interactions imex curation Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity. Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity. Plant Physiol. (0032-0889) 2005 imex curation Choi HI., Park HJ., Park JH., Kim S., Im MY., Seo HH., Kim YW., Hwang I., Kim SY. sooykim@kkpc.com 13-Nov-2007: Contacted by JYOTI. ABA/salt-treated Arabidopsis seedling cDNA library orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Choi HI., Park HJ., Park JH., Kim S., Im MY., Seo HH., Kim YW., Hwang I., Kim SY. sooykim@kkpc.com Accepted 2007-NOV-3 by ORCHARD. 13-Nov-2007: Contacted by JYOTI. ABA/salt-treated Arabidopsis seedling cDNA library Plant Physiol. (0032-0889) 2005 orchard Only protein-protein interactions imex curation Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity. Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity. Plant Physiol. (0032-0889) 2005 imex curation Choi HI., Park HJ., Park JH., Kim S., Im MY., Seo HH., Kim YW., Hwang I., Kim SY. sooykim@kkpc.com 13-Nov-2007: Contacted by JYOTI. ABA/salt-treated Arabidopsis seedling cDNA library orchard Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Choi HI., Park HJ., Park JH., Kim S., Im MY., Seo HH., Kim YW., Hwang I., Kim SY. sooykim@kkpc.com Accepted 2007-NOV-3 by ORCHARD. 13-Nov-2007: Contacted by JYOTI. ABA/salt-treated Arabidopsis seedling cDNA library Plant Physiol. (0032-0889) 2005 orchard Only protein-protein interactions imex curation Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity. Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity. Plant Physiol. (0032-0889) 2005 imex curation Choi HI., Park HJ., Park JH., Kim S., Im MY., Seo HH., Kim YW., Hwang I., Kim SY. sooykim@kkpc.com 13-Nov-2007: Contacted by JYOTI. ABA/salt-treated Arabidopsis seedling cDNA library orchard Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Choi HI., Park HJ., Park JH., Kim S., Im MY., Seo HH., Kim YW., Hwang I., Kim SY. sooykim@kkpc.com Accepted 2007-NOV-3 by ORCHARD. 13-Nov-2007: Contacted by JYOTI. ABA/salt-treated Arabidopsis seedling cDNA library Plant Physiol. (0032-0889) 2005 orchard Only protein-protein interactions imex curation ai5l6_arath ABSCISIC ACID-INSENSITIVE 5-like protein 6 ABF3 BZIP37 DPBF5 Abscisic acid responsive elements-binding factor 3 Dc3 promoter-binding factor 5 bZIP transcription factor 37 F17I5.190/F17I5.200 F28A23.230 At4g34000/At4g34010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSRLNFKSFVDGVSEQQPTVGTSLPLTRQNSVFSLTFDEFQNSWGGGIGKDFGSMNMDELLKNIWTAEESHSMMGNNTSYTNISNGNSGNTVINGGGNNIGGLAVGVGGESGGFFTGGSLQRQGSLTLPRTISQKRVDDVWKELMKEDDIGNGVVNGGTSGIPQRQQTLGEMTLEEFLVRAGVVREEPQPVESVTNFNGGFYGFGSNGGLGTASNGFVANQPQDLSGNGVAVRQDLLTAQTQPLQMQQPQMVQQPQMVQQPQQLIQTQERPFPKQTTIAFSNTVDVVNRSQPATQCQEVKPSILGIHNHPMNNNLLQAVDFKTGVTVAAVSPGSQMSPDLTPKSALDASLSPVPYMFGRVRKTGAVLEKVIERRQKRMIKNRESAARSRARKQAYTMELEAEIAQLKELNEELQKKQVEIMEKQKNQLLEPLRQPWGMGCKRQCLRRTLTGPW B0428D39183374EF cdpkw_arath Calcium-dependent protein kinase 32 CPK32 At3g57530 T8H10.130 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNCCGTAGSLAQNDNKPKKGRKKQNPFSIDYGLHHGGGDGGGRPLKLIVLNDPTGREIESKYTLGRELGRGEFGVTYLCTDKETDDVFACKSILKKKLRTAVDIEDVRREVEIMRHMPEHPNVVTLKETYEDEHAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIMEVVQVCHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVSENAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKKRALRVIAEHLSDEEASGIREGFQIMDTSQRGKINIDELKIGLQKLGHAIPQDDLQILMDAGDIDRDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQNNNGYIEIEELREALSDELGTSEEVVDAIIRDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFNSISLKLMQDASLQVNGDTR FAD0C733CB85C810 ai5l4_arath ABSCISIC ACID-INSENSITIVE 5-like protein 4 ABF1 At1g49720 BZIP35 Abscisic acid responsive elements-binding factor 1 bZIP transcription factor 35 F14J22.7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGTHIDINNLGGDTSRGNESKPLARQSSLYSLTFDELQSTLGEPGKDFGSMNMDELLKNIWTAEDTQAFMTTTSSVAAPGPSGFVPGGNGLQRQGSLTLPRTLSQKTVDEVWKYLNSKEGSNGNTGTDALERQQTLGEMTLEDFLLRAGVVKEDNTQQNENSSSGFYANNGAAGLEFGFGQPNQNSISFNGNNSSMIMNQAPGLGLKVGGTMQQQQQPHQQQLQQPHQRLPPTIFPKQANVTFAAPVNMVNRGLFETSADGPANSNMGGAGGTVTATSPGTSSAENNTWSSPVPYVFGRGRRSNTGLEKVVERRQKRMIKNRESAARSRARKQAYTLELEAEIESLKLVNQDLQKKQAEIMKTHNSELKEFSKQPPLLAKRQCLRRTLTGPW 15F23FD43D021017 ai5l7_arath ABSCISIC ACID-INSENSITIVE 5-like protein 7 ABF4 AREB2 At3g19290 BZIP38 Abscisic acid responsive elements-binding factor 4 ABA-responsive element-binding protein 2 bZIP transcription factor 38 MVI11.7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGTHINFNNLGGGGHPGGEGSSNQMKPTGSVMPLARQSSVYSLTFDELQNTLGGPGKDFGSMNMDELLKSIWTAEEAQAMAMTSAPAATAVAQPGAGIPPPGGNLQRQGSLTLPRTISQKTVDEVWKCLITKDGNMEGSSGGGGESNVPPGRQQTLGEMTLEEFLFRAGVVREDNCVQQMGQVNGNNNNGFYGNSTAAGGLGFGFGQPNQNSITFNGTNDSMILNQPPGLGLKMGGTMQQQQQQQQLLQQQQQQMQQLNQPHPQQRLPQTIFPKQANVAFSAPVNITNKGFAGAANNSINNNNGLASYGGTGVTVAATSPGTSSAENNSLSPVPYVLNRGRRSNTGLEKVIERRQRRMIKNRESAARSRARKQAYTLELEAEIEKLKKTNQELQKKQAEMVEMQKNELKETSKRPWGSKRQCLRRTLTGPW 562FB52A1B493AF3 cdpku_arath Calcium-dependent protein kinase 30 CPK30 At1g74740 CDPK1A Calcium-dependent protein kinase isoform CDPK1a F25A4.29 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNCIACVKFDPDNSKPNQKKKPPRGRQRNPYDDPDGLRTHAPLRVIPMSHQSQISDKYILGRELGRGEFGITYLCTDRETREALACKSISKRKLRTAVDVEDVRREVTIMSTLPEHPNVVKLKATYEDNENVHLVMELCEGGELFDRIVARGHYTERAAATVARTIAEVVRMCHVNGVMHRDLKPENFLFANKKENSALKAIDFGLSVLFKPGERFTEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVALAILRGVLDFKRDPWSQISESAKSLVKQMLEPDSTKRLTAQQVLDHPWIQNAKKAPNVPLGDIVRSRLKQFSMMNRLKKKALRVIAEHLSIQEVEVIRNMFTLMDDDNDGKISYLELRAGLRKVGSQLGEPEIKLLMEVADVNGNGCLDYGEFVAVIIHLQKMENDEHFRQAFMFFDKDGSGYIESEELREALTDELGEPDNSVIIDIMREVDTDKDGKINYDEFVVMMKAGTDWRKASRQYSRERFKSLSLNLMKDGSMHLHDALTGQSIAV 7D170F76BAFCB4C4 cdpka_arath Calcium-dependent protein kinase 10 Calcium-dependent protein kinase isoform CDPK1 CPK10 At1g18890 CDPK1 F6A14.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNCNACVRPDSKESKPSSKPKKPNRDRKLNPFAGDFTRSPAPIRVLKDVIPMSNQTQISDKYILGRELGRGEFGITYLCTDRETHEALACKSISKRKLRTAVDIEDVRREVAIMSTLPEHPNVVKLKASYEDNENVHLVMELCEGGELFDRIVARGHYTERAAAAVARTIAEVVMMCHSNGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKPGDKFTEIVGSPYYMAPEVLKRDYGPGVDVWSAGVIIYILLCGVPPFWAETEQGVALAILRGVLDFKRDPWPQISESAKSLVKQMLDPDPTKRLTAQQVLAHPWIQNAKKAPNVPLGDIVRSRLKQFSMMNRFKKKVLRVIAEHLSIQEVEVIKNMFSLMDDDKDGKITYPELKAGLQKVGSQLGEPEIKMLMEVADVDGNGFLDYGEFVAVIIHLQKIENDELFKLAFMFFDKDGSTYIELDELREALADELGEPDASVLSDIMREVDTDKDGRINYDEFVTMMKAGTDWRKASRQYSRERFKSLSINLMKDGSLHLHDALTGQTVPV A505FB320E7818E9 ai5l5_arath ABSCISIC ACID-INSENSITIVE 5-like protein 5 ABF2 AREB1 At1g45249 Abscisic acid responsive elements-binding factor 2 ABA-responsive element-binding protein 1 bZIP transcription factor 36 T2P3 BZIP36 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDGSMNLGNEPPGDGGGGGGLTRQGSIYSLTFDEFQSSVGKDFGSMNMDELLKNIWSAEETQAMASGVVPVLGGGQEGLQLQRQGSLTLPRTLSQKTVDQVWKDLSKVGSSGVGGSNLSQVAQAQSQSQSQRQQTLGEVTLEEFLVRAGVVREEAQVAARAQIAENNKGGYFGNDANTGFSVEFQQPSPRVVAAGVMGNLGAETANSLQVQGSSLPLNVNGARTTYQQSQQQQPIMPKQPGFGYGTQMGQLNSPGIRGGGLVGLGDQSLTNNVGFVQGASAAIPGALGVGAVSPVTPLSSEGIGKSNGDSSSLSPSPYMFNGGVRGRKSGTVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEENDELQRKQARIMEMQKNQETEMRNLLQGGPKKKLRRTESGPW DIP protein Q9M7Q4 original sequence version: 50 F5E77595B355EBF2 abf4-cpk32 1 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association 1 Specificity of interaction.Interaction of AtCPK32 with an unrelated protein, nuclear lamin (lamin), or with the C2-C3 region of ABF4 was investigated by two-hybrid assay. abf4-cpk32-1 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 1D Thus, our in vitro interaction assay indicated that AtCPK32 interacts with ABF4 in vitro. abf4-cpk32-2 2 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q9M7Q2:p.Ser110Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:43:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser110ala' Tue Jun 30 16:21:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser110Ala' 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 24 27 physical association physical association 2, 4D In summary, our results indicated that full-length AtCPK32 is necessary for the normal interaction with the C2-C3 region of ABF4. Although necessary, the kinase domain was not sufficient for the interaction, and both the N-terminal variable region and the C-terminal EF hand region were required. cpk32-abf4 4 8 enzyme target enzyme target substrate substrate neutral component neutral component n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9M7Q2:p.Ser110Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:02:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser110ala' Tue Jun 30 18:14:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser110Ala' ecobb Escherichia coli (strain B / BL21) 6 enzyme enzyme neutral component neutral component ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation 4 Ser-110 of ABF4 May Be Phosphorylated by AtCPK32 Probable phosphorylation of Ser-110 (Serine residue at position 110) of ABFF4 protein. autophosphorylation of Q6NLQ6 abf1-cpk32 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association 7 Interaction between ABF family members and CDPKs. Interaction between AtCPK32 and ABF family members (ABF1, ABF2, or ABF3) abf2-cpk32 2 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association 7 Interaction between ABF family members and CDPKs. Interaction between AtCPK32 and ABF family members (ABF1, ABF2, or ABF3) abf3-cpk32 2 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association 7 Interaction between ABF family members and CDPKs. Interaction between AtCPK32 and ABF family members (ABF1, ABF2, or ABF3) abf4-cpk10 2 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 7 First, ABF4 interacts also with AtCPK10 and AtCPK30, abf4-cpk30 2 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 7 First, ABF4 interacts also with AtCPK10 and AtCPK30, cpk32 4 6 putative self putative self putative self putative self ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation true 4 Full-length, recombinant AtCPK32 (Fig. 4A, lane 2) was prepared, and its autophosphorylation activity was investigated by monitoring the incorporation of [g-32P]ATP. Figure 4A (lane 4) shows that the radioactivity was incorporated into AtCPK32 in the assay, indicating that autophosphorylation occurred. Autophosphorylation of Q6NLQ6