IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ An Arabidopsis GRIP domain protein locates to the trans-Golgi and binds the small GTPase ARL1. An Arabidopsis GRIP domain protein locates to the trans-Golgi and binds the small GTPase ARL1. Plant J. (0960-7412) 2005 imex curation Latijnhouwers M., Hawes C., Carvalho C., Oparka K., Gillingham AK., Boevink P. petra.boevink@scri.ac.uk 22-Jan-2008: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Latijnhouwers M., Hawes C., Carvalho C., Oparka K., Gillingham AK., Boevink P. petra.boevink@scri.ac.uk Accepted 2007-DEC-14 by JYOTI. 22-Jan-2008: Contacted by JYOTI. Plant J. (0960-7412) 2005 Only protein-protein interactions imex curation An Arabidopsis GRIP domain protein locates to the trans-Golgi and binds the small GTPase ARL1. An Arabidopsis GRIP domain protein locates to the trans-Golgi and binds the small GTPase ARL1. Plant J. (0960-7412) 2005 imex curation Latijnhouwers M., Hawes C., Carvalho C., Oparka K., Gillingham AK., Boevink P. petra.boevink@scri.ac.uk 22-Jan-2008: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Latijnhouwers M., Hawes C., Carvalho C., Oparka K., Gillingham AK., Boevink P. petra.boevink@scri.ac.uk Accepted 2007-DEC-14 by JYOTI. Plant J. (0960-7412) 2005 Only protein-protein interactions imex curation arf3_arath ADP-ribosylation factor 3 ARF3 F27A10.8 F27C12.31 At2g24765 ARL1 Protein ARF-LIKE 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGILFTRMFSSVFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTQAVIYVVDSSDTDRIGVAKEEFHAILEEDELKGAVVLIFANKQDLPGALDDAAVTEALELHKIKSRQWAIFKTCAVKGEGLFEGLDWLSNTLKSGSG F5271FBBC69BAD7D grip_arath Protein GRIP GRIP K2A18.10 At5g66030 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSEDKESDVVGEEEESHVIKEDKELNDASNETLTENGDQLLQMIAELRLENDFLRSQFEGLKDEVAQGRSLQKAEQVEADSAQLKQLQEQVASLSREIDVEKQTRVAAEQALEHLREAYSEADAKSQEYSSKFSQVEQKLDQEIKERDEKYADLDAKFTRLHKRAKQRIQEIQKEKDDLDARFREVNETAERASSQHSSMQQELERTRQQANEALKAMDAERQQLRSANNKLRDTIEELRGSLQPKENKIETLQQSLLDKDQILEDLKKQLQAVEERKQIAVTELSAKHQKNLEGLEAQVVDALSERDKAAETISSLQVLLAEKESKIAEMEAAATGEAARLRAAAETLKGELAHLKSENEKEKETWEASCDALKSKLEIAESNYLQAEIEVAKMRSQLGSEMSMQTQILSTKDAELKGAREEINRLQSEFSSYKIRAHALLQKKDMELAAAKDSEQIKSLEEALKEAEKEVYLVSAERDRAQQDLQSALASLEKELEERAGALKDASEQIKSLEVKLDSTVARNQAEKQAWEEDLRVLEETWRRRCEALTAQNEASPAEGIEKELENAKLRNKRMKEEHESVRELADRLIEEKDREISRLVDEMTNLRKSMESKPVWNKSPSQVHHYGNNNTESQQQDVSNLSTSAAEHQILILARQQAQREEELAQTQRHILALQEEIEELERENRLHSQQEAVLKTELREMERKQKREGVDMTYLKNVILKLLETGEVEALLPVVGMLLQFSPEEIQKCQQAYHSSTTAATTTEATPSPASEGSGLSVFSRFSFS C2B98C5E8A20B10F arl1-grip 2 4 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q8S2T0:p.Tyr717Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:06:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr717ala' Tue Jun 30 16:03:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr717Ala' 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P40940:p.Thr31Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T N Wed May 02 18:40:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr31asn' Tue Jun 30 19:53:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr31Asn' region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association the first 14 amino acds of the ARL1 protein (P40940) were removed to improve solubility of the GST-protein construct. 7 As shown in the top panel of Figure 7(a), there was clear binding between the His6-tagged GRIP domain and GST-ARL1 in the presence of GTPcS. In the presence of GDP, no binding was observed. The interaction was dependent on the presence of the non-hydrolysable GTP analogue, GTPgammaS. GDP arl1-grip-1 1 4 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P40940:p.Gln71Leu mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 17:10:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln71Leu' physical association physical association 7C.d Only the combination of GAL4BD-AtGRIP or GAL4BD-GRIP2 with GAL4AD-ARL1-Q71L produced colonies