IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Bud14p-Glc7p complex functions as a cortical regulator of dynein in budding yeast. The Bud14p-Glc7p complex functions as a cortical regulator of dynein in budding yeast. EMBO J. (0261-4189) 2005 Knaus M., Cameroni E., Pedruzzi I., Tatchell K., De Virgilio C., Peter M. claudio.devirgilio@medecine.unige.ch 07-Sept-2007: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Knaus M., Cameroni E., Pedruzzi I., Tatchell K., De Virgilio C., Peter M. claudio.devirgilio@medecine.unige.ch Accepted 2007-SEP-2 by JYOTI. 07-Sept-2007: Contacted by JYOTI. EMBO J. (0261-4189) 2005 The Bud14p-Glc7p complex functions as a cortical regulator of dynein in budding yeast. The Bud14p-Glc7p complex functions as a cortical regulator of dynein in budding yeast. EMBO J. (0261-4189) 2005 Knaus M., Cameroni E., Pedruzzi I., Tatchell K., De Virgilio C., Peter M. claudio.devirgilio@medecine.unige.ch 07-Sept-2007: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Knaus M., Cameroni E., Pedruzzi I., Tatchell K., De Virgilio C., Peter M. claudio.devirgilio@medecine.unige.ch Accepted 2007-SEP-2 by JYOTI. 07-Sept-2007: Contacted by JYOTI. EMBO J. (0261-4189) 2005 bud14_yeast Bud site selection protein 14 FUN2 YAR014C BUD14 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNKEEHVDETSASGVKEVSSIAARHDNGYAPSLITSTSGMDSFQSHALLNDPTLIEDYSDIINNRPTSGSKLTLGNEDSESMGGSVVVTPTSNKSSPFNSKLNILSNAAEKGHDVLRNRDDDKELEEENVEKHMHSNSKRDQRHYKENSSELPDSYDYSDSEFEDNLERRLQEIETDSVDSADKDEVHFSVNNTMNPDVDDFSDGLKYAISEDEDEEENYSDDDDFDRKFQDSGFQGEKDDLEEENDDYQPLSPPRELDPDKLYALYAFNGHDSSHCQLGQDEPCILLNDQDAYWWLVKRITDGKIGFAPAEILETFPERLARLNCWKNENMSSQSVASSDSKDDSISSGNKNQSDAESIIPTPALNGYGKGNKSVSFNDVVGYADRFIDDAIEDTSLDSNDDGGEGNGQSYDDDVDNDKETKVTHRDEYTEAKLNFGKFQDDDTSDVVSDVSFSTSLNTPLNVKKVRRQDNKNESEPKTSSSKDREDDYNANRYVGQEKSEPVDSDYDTDLKKVFEAPRMPFANGMAKSDSQNSLSTIGEFSPSSSEWTNESPSTPIVEESSSIPSSRAIKDISQYIHAKSKIEETTNVENTEGQIQASLGSSGGMANQTDAEQPKEELEKHHSTPEEEKQSTLSLHSSSEEDFYMDEQRAVSSASINSSLSGSRALSNTNMSDPASKPNSLVQHLYAPVFDRMDVLMKQLDEIIRK F123511A4C592EB4 F123511A4C592EB4 bem2_yeast GTPase-activating protein BEM2/IPL2 Bud emergence protein 2 YER155C BEM2 IPL2 SUP9 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKGLLWSKNRKSSTASASSSSTSTSHKTTTASTASSSSPSSSSQTIRNSTSGASPYMHSHHHHGQGHSHHRGEDNNRDKRKSSVFPPSKQYTSTSSSQVNLGMYHSDTNTRSSRSIASTLKDDSPSVCSEDEISNSSSQKSNAQDETPIAYKKSAHSKDSLLPSRSSSLSPPQSRCSTGTTLEKSLNTSGISNSSGTNNNNSNNNNDNEQKQRNVIHLNSENYDTTVFKTGWVNKSHGQTVATNYNSSMTAPSSSSSSSSQNLRNDAYSRNRESRFYGNDGSSLKNDDSSSTTATNSGNDVASARSSMAIDPQMLVPDYRLYRAQLKGCVLNLYKSGLNSNIKFFDPTLPASNSSIANENHQQKKQQTNNQAQAEALHQKQSFGQMGEPITLDLKYLSEVYPHPDLRQDSDGKIISGTIESLCHTVLFYPGPKQSDVPNEKSLSKTHRAVINLLLMFPLLDHFIKFLKVFNQFGLSFTKNKSRLTNNSTQFYNISPAVDDSMTQRLALTAKTILDVFPGFLLDEPMLKTIISLLDTISLHNDEISNNLKIKIANKHNELMKLTAFTRSLPMATSSTHELEIILDPSHFLSLDITTLADEVHHINLKFDKVWAPKFDYSLLYDSKFINRRIVSLNPLVFNNDQNIHFLGRLLISHLFPTNPEFSKKVTPKVRAELLDKWVQIGCRFEHLGDMVSWLAVATIICSIPVLRSSSWKYVPDQSLKTIFKDWVPTIIQLERRQRTSKSTSSVFILAPPNLDDDFTRANVISYFGDLLIHADDLPSDTKFKYLEKKINRTKNAFHKWQQRLQAIDSTRHKTNSTENVRDNDSPNNVVYQLWKFHLSQPPLNIEGIMKLSVQHEPPIIDQKAYSTIGSQRSALVTGSYLPILFNELFPNYSLFPKNTLVGAASDAKLPPPRSSARLSKSLSISEPIPIASNSHTMGSLTDDAMSSKNDNNKVTGVGKIDGPVIKEMSSKQSNKQRLLKSVRDVFNIDMDVFHISDELVFKSVYDNDGKSRPASMVIETPKRFSQHSSMLINNPATPNQKMRDSLDTTGRLSKTLENMDFFNNIGQVSDSLKESIIRVVLKSSSLEKIFDLLVLTSNIFSKLVDTKDLENYYYHQRQRGHSTRGLSDDNIGLLDYAFVKLTMDNDIFTETFFNTYKSFTTTTTVLENMAKRYVGAKSCSVSISKILDRSDDSKMKINEDTNLVSSSLYDQNFPVWDMKVTDDENINLIYMAKIQIGAAEAILHLVKNHYSDFTDDLCNNSTLLDIIKIMEQEVSTEWPTRIANSKLQKSLPENFVIETENLLTTLTDLFHGIKSAYQKQLYRPIGVNRTQKRITDILNSFNTFSFTDLNNIIDDPSFSDDMIRSFQKLHSTNYEDILEWIYQLDNFISKKFNLVSKKDWIVLFQELELLSKESLVSFFNYPLHFKSSKLINPGYLQLHEFEISNLFTWISTLILKDDNGTESLFFEKLPQSIKLLIKLHTSLTTFFVMEISNVNKSSSERLTTCKVILQILNYIRWKNGSLDLFDSEEDESPHAICPHIPAFIETAIAHAIISPESRNYELSWIKASEKLSDPTKGTQNLRSISNVLEKIDDIHIKRFIEIDDVFSKNCKNLCPCPGWFISRLLEISQFVPNMSITNSKLINFDKRRFVNNIISNVLDLIPNEREFPLDIEMSDENPSKRTTFGRILFNNFEDVNKVYRKKTKKVSESEAISERFQEQGVFNEILVNEIEKIKREARKLEVLLDQEKILKNSAALHQAVPKKNRKSVIISGTHSDNDHSYNINKNTGQTPSLGSVMESNNSARNRRDSRASFSTNRSSVVSNSSHNGVSKKIGGFFRRPFSIGGFNTSSSNYSLNSILSQEVSSNKSILPSILPEVDSMQLHDLKPSYSLKTFEIKSIMEIINHRNIPAYYYAFKIVMQNGHEYLIQTASSSDLTEWIKMIKASKRFSFHSKKYKGKTHNKIFGVPLEDVCERENTLIPTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDDRWFEVNAIAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYKRMMNELLQKLPTCYYQTLKRIVFHLNKVHQHVVNNKMDASNLAIVFSMSFINQEDLANSMGSRLGAVQTILQDFIKNPNDYFKQ DB7F4CD417E898F0 DB7F4CD417E898F0 pp12_yeast Serine/threonine-protein phosphatase PP1-2 GLC7 CID1 DIS2 YER133W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQKSLPRQAGGRKKK 71B20E3A4ED93235 71B20E3A4ED93235 bud14-glc7-1 2 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P27637:p.Val377Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Wed May 02 20:23:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val377ala' Tue Jun 30 17:27:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val377Ala' P27637:p.Phe379Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 16:15:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe379ala' Tue Jun 30 17:47:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe379Ala' physical association physical association As shown in Table I, Bud14p fused to the activation domain (AD) strongly interacted with Glc7p fused to the DNA-binding domain (DBD). Table I bud14-bem2-1 2 3 unspecified role unspecified role bait bait P27637:p.Phe379Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 19:29:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe379ala' Tue Jun 30 19:56:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe379Ala' 4 unspecified role unspecified role prey prey physical association physical association Table I bud14-glc7-2 2 5 unspecified role unspecified role prey prey undefined mutation arg186-187ala, arg190ala, asn298lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:28:08 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutations' 3 unspecified role unspecified role bait bait physical association physical association As shown in Table I, Bud14p fused to the activation domain (AD) strongly interacted with Glc7p fused to the DNA-binding domain (DBD). Table I bud14-glc7-3 1 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P27637:p.Val377Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Wed May 02 14:35:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val377ala' Tue Jun 30 16:50:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val377Ala' P27637:p.Phe379Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 14:59:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe379ala' Tue Jun 30 16:18:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe379Ala' physical association physical association Importantly, specific point mutations in the Glc7p-interaction motif of Bud14p (V377A and F379A; Figure 4A) strongly diminished its ability to interact with Glc7p both by two-hybrid (Table I) and coimmunoprecipitation assays (Figure 4B), implying that Glc7p indeed interacts with Bud14p through this conserved domain. Figure 4B