IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Trm11p and Trm112p are both required for the formation of 2-methylguanosine at position 10 in yeast tRNA. Trm11p and Trm112p are both required for the formation of 2-methylguanosine at position 10 in yeast tRNA. Mol. Cell. Biol. (0270-7306) 2005 imex curation Purushothaman SK., Bujnicki JM., Grosjean H., Lapeyre B. bruno.lapeyre@crbm.cnrs.fr 29-OCT-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Purushothaman SK., Bujnicki JM., Grosjean H., Lapeyre B. bruno.lapeyre@crbm.cnrs.fr Accepted 2007-JUN-22 by DAVET. Mol. Cell. Biol. (0270-7306) 2005 Only protein-protein interactions imex curation Trm11p and Trm112p are both required for the formation of 2-methylguanosine at position 10 in yeast tRNA. Trm11p and Trm112p are both required for the formation of 2-methylguanosine at position 10 in yeast tRNA. Mol. Cell. Biol. (0270-7306) 2005 imex curation Purushothaman SK., Bujnicki JM., Grosjean H., Lapeyre B. bruno.lapeyre@crbm.cnrs.fr 29-OCT-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Purushothaman SK., Bujnicki JM., Grosjean H., Lapeyre B. bruno.lapeyre@crbm.cnrs.fr Accepted 2007-JUN-22 by DAVET. 29-OCT-2007: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2005 Only protein-protein interactions imex curation trna ile uau trna ile uau trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCUCGUGUAGCUCAGUGGUUAGAGCUUCGUGCUUAUAACGCGACCGUCGUGGGUUCAAACCCCACCUCGAGCA tr112_yeast Multifunctional methyltransferase subunit TRM112 YNR046W N3445 TRM112 tRNA methyltransferase 112 eRF1 methyltransferase subunit TRM112 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV 3CFB2ABDDFB0E38A trm11_yeast tRNA (guanine(10)-N2)-methyltransferase tRNA [Gm10] methyltransferase tRNA methylase 11 TRM11 YOL124C tRNA guanosine-2'-O-methyltransferase TRM11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKKYLLYMVQVHLNFRRAELESLADLYNLSIDFSQYDANSPFFIVELENDQQAKDWIKRSILTRGIYEYWGQGTTLDELHKDIQRQSNFEQDLQLKFKHSTFKFEFECYKGNSKAKRVEQIETFRYLGFEGKIDMKHPQEVFTVIEEYTPISENVGGKTPTRIYFGRQVQMSNRSAMEKYDLKKRPYKGTTSFEAELSLVSANIAQVKPGTIMYDPFAGTGSFLVAGGHFGSLVIGSDIDGRMIRGKGAQVNISANFKKYGESSQFLDVLTMDFTNNALRNNLVIDTILCDPPYGIRESIKVLGAKDPERFLGKEDMEIDGEKAYLRRDYIPTKKPYALDSLLDDLLQYSSERLPIGGRLAFWMPTANDANIETIVPMHENLELKYNCVQEFNKWSRRLLVYINRGSTFNGSSNHGIKRSKDNFRERYFNNFN 61B291029D55263D trm11-trm112-1 1 4 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The direct association of Trm11p and Trm112p was then tested by coimmunoprecipitation analysis. 4C trna ile-1 2 5 enzyme enzyme neutral component neutral component yeast Saccharomyces cerevisiae Baker's yeast 4 enzyme regulator enzyme regulator neutral component neutral component tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeast Saccharomyces cerevisiae Baker's yeast 3 enzyme target enzyme target substrate substrate neutral component neutral component G methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain in vitro In vitro methylation methylation reaction methylation Fig 4A