IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ An Arabidopsis NPR1-like gene, NPR4, is required for disease resistance. An Arabidopsis NPR1-like gene, NPR4, is required for disease resistance. Plant J. (0960-7412) 2005 Liu G., Holub EB., Alonso JM., Ecker JR., Fobert PR. pierre.fobert@nrc-cnrc.gc.ca 22-Jan-2008: Contacted by JYOTI. orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Liu G., Holub EB., Alonso JM., Ecker JR., Fobert PR. pierre.fobert@nrc-cnrc.gc.ca Accepted 2007-DEC-6 by ORCHARD. Plant J. (0960-7412) 2005 orchard tga6_arath Transcription factor TGA6 TGA6 BZIP45 At3g12250 F28J15.6 MQC3.8 bZIP transcription factor 45 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSSRTDVSTDGDTDHRDLGSDRGHMHAAASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDYSSRLRALSSLWLARPRE 2A55F2F336648A48 nimi3_arath Protein NIM1-INTERACTING 3 NIMIN-3 At1g09415 F14J9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDRDRKRVKMEKEDDEEEKMEKLYTVLKNAREMRKYVNSSMEKKRQEEEERARVRRFPSFQPEDFIFMNKAEANNIEKAANESSSASNEYDGSKEKQEGSETNVCLDLNLSL 18048FD42FBC53C9 npr1_arath Regulatory protein NPR1 SAI1 BTB/POZ domain-containing protein NPR1 NPR1 NIM1 At1g64280 F15H21.6 Nonexpresser of PR genes 1 Non-inducible immunity protein 1 Salicylic acid insensitive 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTTIDGFADSYEISSTSFVATDNTDSSIVYLAAEQVLTGPDVSALQLLSNSFESVFDSPDDFYSDAKLVLSDGREVSFHRCVLSARSSFFKSALAAAKKEKDSNNTAAVKLELKEIAKDYEVGFDSVVTVLAYVYSSRVRPPPKGVSECADENCCHVACRPAVDFMLEVLYLAFIFKIPELITLYQRHLLDVVDKVVIEDTLVILKLANICGKACMKLLDRCKEIIVKSNVDMVSLEKSLPEELVKEIIDRRKELGLEVPKVKKHVSNVHKALDSDDIELVKLLLKEDHTNLDDACALHFAVAYCNVKTATDLLKLDLADVNHRNPRGYTVLHVAAMRKEPQLILSLLEKGASASEATLEGRTALMIAKQATMAVECNNIPEQCKHSLKGRLCVEILEQEDKREQIPRDVPPSFAVAADELKMTLLDLENRVALAQRLFPTEAQAAMEIAEMKGTCEFIVTSLEPDRLTGTKRTSPGVKIAPFRILEEHQSRLKALSKTVELGKRFFPRCSAVLDQIMNCEDLTQLACGEDDTAEKRLQKKQRYMEIQETLKKAFSEDNLELGNSSLTDSTSSTSKSTGGKRSNRKLSHRRR DIP protein P93002 original sequence version: 106 DDD618146254CD68 tga3_arath Transcription factor TGA3 TGA3 BZIP22 At1g22070 F2E2.14 bZIP transcription factor 22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEMMSSSSSTTQVVSFRDMGMYEPFQQLSGWESPFKSDINNITSNQNNNQSSSTTLEVDARPEADDNNRVNYTSVYNNSLEAEPSSNNDQDEDRINDKMKRRLAQNREAARKSRLRKKAHVQQLEESRLKLSQLEQELVRARQQGLCVRNSSDTSYLGPAGNMNSGIAAFEMEYTHWLEEQNRRVSEIRTALQAHIGDIELKMLVDSCLNHYANLFRMKADAAKADVFFLMSGMWRTSTERFFQWIGGFRPSELLNVVMPYVEPLTDQQLLEVRNLQQSSQQAEEALSQGLDKLQQGLVESIAIQIKVVESVNHGAPMASAMENLQALESFVNQADHLRQQTLQQMSKILTTRQAARGLLALGEYFHRLRALSSLWAARPREHT 48F965F62A2980A9 tga2_arath Transcription factor TGA2 TGA2 BZIP20 HBP1B At5g06950 MOJ9.12 HBP-1b homolog bZIP transcription factor 20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSPRTDVSTDDDTDHPDLGSEGALVNTAASDSSDRSKGKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISGTGDQAHSTGGNGALAFDAEHSRWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDYFSRLRALSSLWLARPRE D3033153BCE932C4 tga5_arath Transcription factor TGA5 TGA5 BZIP26 OBF5 At5g06960 MOJ9.13 Ocs element-binding factor 5 bZIP transcription factor 26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGDTSPRTSVSTDGDTDHNNLMFDEGHLGIGASDSSDRSKSKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTAGDGAMAFDVEYRRWQEDKNRQMKELSSAIDSHATDSELRIIVDGVIAHYEELYRIKGNAAKSDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLIASQLEPLTEQQSLDINNLQQSSQQAEDALSQGMDNLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTYQQMVRLLTTRQSARALLAVHNYTLRLRALSSLWLARPRE 645062F0F3351869 tga7_arath Transcription factor TGA7 TGA7 BZIP50 At1g77920 F28K19.13 bZIP transcription factor 50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMSSSSPTQLASLRDMGIYEPFQQIVGWGNVFKSDINDHSPNTATSSIIQVDPRIDDHNNNIKINYDSSHNQIEAEQPSSNDNQDDDGRIHDKMKRRLAQNREAARKSRLRKKAYVQQLEESRLKLSQLEQELEKVKQQGHLGPSGSINTGIASFEMEYSHWLQEQSRRVSELRTALQSHISDIELKMLVESCLNHYANLFQMKSDAAKADVFYLISGMWRTSTERFFQWIGGFRPSELLNVVMPYLQPLTDQQILEVRNLQQSSQQAEDALSQGIDKLQQSLAESIVIDAVIESTHYPTHMAAAIENLQALEGFVNQADHLRQQTLQQMAKILTTRQSARGLLALGEYLHRLRALSSLWAARPQEPT 3C6CBF4D070C2D0A npr4_arath Regulatory protein NPR4 BTB/POZ domain-containing protein NPR4 T16H5.20 NPR4 At4g19660 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAATAIEPSSSISFTSSHLSNPSPVVTTYHSAANLEELSSNLEQLLTNPDCDYTDAEIIIEEEANPVSVHRCVLAARSKFFLDLFKKDKDSSEKKPKYQMKDLLPYGNVGREAFLHFLSYIYTGRLKPFPIEVSTCVDSVCAHDSCKPAIDFAVELMYASFVFQIPDLVSSFQRKLRNYVEKSLVENVLPILLVAFHCDLTQLLDQCIERVARSDLDRFCIEKELPLEVLEKIKQLRVKSVNIPEVEDKSIERTGKVLKALDSDDVELVKLLLTESDITLDQANGLHYAVAYSDPKVVTQVLDLDMADVNFRNSRGYTVLHIAAMRREPTIIIPLIQKGANASDFTFDGRSAVNICRRLTRPKDYHTKTSRKEPSKYRLCIDILEREIRRNPLVSGDTPTCSHSMPEDLQMRLLYLEKRVGLAQLFFPAEANVAMDVANVEGTSECTGLLTPPPSNDTTENLGKVDLNETPYVQTKRMLTRMKALMKTVETGRRYFPSCYEVLDKYMDQYMDEEIPDMSYPEKGTVKERRQKRMRYNELKNDVKKAYSKDKVARSCLSSSSPASSLREALENPT DIP protein Q5ICL9 original sequence version: 50 11DCA45A220A7F46 npr4-tga2 1 9 unspecified role unspecified role bait bait Q5ICL9:p.His321Tyr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain H Y Wed May 02 17:10:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his321tyr' Tue Jun 30 17:58:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His321Tyr' 6 unspecified role unspecified role prey prey physical association physical association 2 The entire coding region of NPR4 was inserted into the GAL4 DNA binding domain (DB) fusion expression vector pBI880 (Kohalmi et al., 1997) and co-transformed into yeast cells along with the GAL4 transactivation domain (TA) fusion expression vector pBI881 containing the coding region from one of the TGA factors or NIMIN3. XGAL filter assays of colonies harboring NPR4:DB along with TA fusions of TGA2, TGA3, TGA5, TGA6, or TGA7 yielded a blue color (Figure 2a), indicating that NPR4 interacts with these TGA factors. npr4-tga3 1 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 2 The entire coding region of NPR4 was inserted into the GAL4 DNA binding domain (DB) fusion expression vector pBI880 (Kohalmi et al., 1997) and co-transformed into yeast cells along with the GAL4 transactivation domain (TA) fusion expression vector pBI881 containing the coding region from one of the TGA factors or NIMIN3. XGAL filter assays of colonies harboring NPR4:DB along with TA fusions of TGA2, TGA3, TGA5, TGA6, or TGA7 yielded a blue color (Figure 2a), indicating that NPR4 interacts with these TGA factors. npr4-tga5 1 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 2 The entire coding region of NPR4 was inserted into the GAL4 DNA binding domain (DB) fusion expression vector pBI880 (Kohalmi et al., 1997) and co-transformed into yeast cells along with the GAL4 transactivation domain (TA) fusion expression vector pBI881 containing the coding region from one of the TGA factors or NIMIN3. XGAL filter assays of colonies harboring NPR4:DB along with TA fusions of TGA2, TGA3, TGA5, TGA6, or TGA7 yielded a blue color (Figure 2a), indicating that NPR4 interacts with these TGA factors. npr4-tga6 1 2 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 2 The entire coding region of NPR4 was inserted into the GAL4 DNA binding domain (DB) fusion expression vector pBI880 (Kohalmi et al., 1997) and co-transformed into yeast cells along with the GAL4 transactivation domain (TA) fusion expression vector pBI881 containing the coding region from one of the TGA factors or NIMIN3. XGAL filter assays of colonies harboring NPR4:DB along with TA fusions of TGA2, TGA3, TGA5, TGA6, or TGA7 yielded a blue color (Figure 2a), indicating that NPR4 interacts with these TGA factors. npr4-tga7 1 9 unspecified role unspecified role bait bait Q5ICL9:p.His321Tyr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain H Y Wed May 02 17:25:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his321tyr' Tue Jun 30 17:43:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His321Tyr' 8 unspecified role unspecified role prey prey physical association physical association 2 The entire coding region of NPR4 was inserted into the GAL4 DNA binding domain (DB) fusion expression vector pBI880 (Kohalmi et al., 1997) and co-transformed into yeast cells along with the GAL4 transactivation domain (TA) fusion expression vector pBI881 containing the coding region from one of the TGA factors or NIMIN3. XGAL filter assays of colonies harboring NPR4:DB along with TA fusions of TGA2, TGA3, TGA5, TGA6, or TGA7 yielded a blue color (Figure 2a), indicating that NPR4 interacts with these TGA factors. npr1-tga7-1 1 8 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2 NPR4 interacts with these TGA factors. Cells harboring NPR4:DB along with TA fusions of either TGA1, TGA4, or NIMIN3 produced a white color indicating that NPR4 does not interact with these proteins in yeast. NPR1:DB interacts with the same spectrum of TGA factors as does NPR4 (Figure 2a). However, unlike NPR4, NPR1 also interacts with NIMIN3. npr1-tga6-2 1 2 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2 NPR4 interacts with these TGA factors. Cells harboring NPR4:DB along with TA fusions of either TGA1, TGA4, or NIMIN3 produced a white color indicating that NPR4 does not interact with these proteins in yeast. NPR1:DB interacts with the same spectrum of TGA factors as does NPR4 (Figure 2a). However, unlike NPR4, NPR1 also interacts with NIMIN3. npr1-tga5-1 1 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2 NPR4 interacts with these TGA factors. Cells harboring NPR4:DB along with TA fusions of either TGA1, TGA4, or NIMIN3 produced a white color indicating that NPR4 does not interact with these proteins in yeast. NPR1:DB interacts with the same spectrum of TGA factors as does NPR4 (Figure 2a). However, unlike NPR4, NPR1 also interacts with NIMIN3. npr1-tga3-2 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2 NPR4 interacts with these TGA factors. Cells harboring NPR4:DB along with TA fusions of either TGA1, TGA4, or NIMIN3 produced a white color indicating that NPR4 does not interact with these proteins in yeast. NPR1:DB interacts with the same spectrum of TGA factors as does NPR4 (Figure 2a). However, unlike NPR4, NPR1 also interacts with NIMIN3. npr1-tga2-3 1 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2 NPR4 interacts with these TGA factors. Cells harboring NPR4:DB along with TA fusions of either TGA1, TGA4, or NIMIN3 produced a white color indicating that NPR4 does not interact with these proteins in yeast. NPR1:DB interacts with the same spectrum of TGA factors as does NPR4 (Figure 2a). However, unlike NPR4, NPR1 also interacts with NIMIN3. npr1-nimin_3 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2 However, unlike NPR4, NPR1 also interacts with NIMIN3.