IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interactions between co-expressed Arabidopsis sucrose transporters in the split-ubiquitin system. Interactions between co-expressed Arabidopsis sucrose transporters in the split-ubiquitin system. BMC Biochem. 2003 imex curation Schulze WX., Reinders A., Ward J., Lalonde S., Frommer WB. waltraud@bmb.sdu.dk 22-Jan-2008: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Schulze WX., Reinders A., Ward J., Lalonde S., Frommer WB. waltraud@bmb.sdu.dk Accepted 2007-DEC-14 by JYOTI. BMC Biochem. 2003 Only protein-protein interactions imex curation suc2_arath Sucrose transport protein SUC2 Sucrose permease 2 Sucrose-proton symporter 2 Sucrose transporter 1 SUC2 SUT1 T22J18.12 At1g22710 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVSHPMEKAANGASALETQTGELDQPERLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGHSMGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFFMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLIVTFVSLCYVKEKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWFPFLLFDTDWMGREVYGGNSDATATAASKKLYNDGVRAGALGLMLNAIVLGFMSLGVEWIGRKLGGAKRLWGIVNFILAICLAMTVVVTKQAENHRRDHGGAKTGPPGNVTAGALTLFAILGIPQAITFSIPFALASIFSTNSGAGQGLSLGVLNLAIVVPQMVISVGGGPFDELFGGGNIPAFVLGAIAAAVSGVLALTVLPSPPPDAPAFKATMGFH F412AFF8474FC12A suc3_arath Sucrose transport protein SUC3 Sucrose permease 3 Sucrose-proton symporter 3 Sucrose transporter 2 SUC3 SUT2 T17M13.3 At2g02860 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSDSVSISVPYRNLRKEIELETVTKHRQNESGSSSFSESASPSNHSDSADGESVSKNCSLVTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWLCGPITGLVVQPFVGIWSDKCTSKYGRRRPFILVGSFMISIAVIIIGFSADIGYLLGDSKEHCSTFKGTRTRAAVVFIIGFWLLDLANNTVQGPARALLADLSGPDQRNTANAVFCLWMAIGNILGFSAGASGKWQEWFPFLTSRACCAACGNLKAAFLLAVVFLTICTLVTIYFAKEIPFTSNKPTRIQDSAPLLDDLQSKGLEHSKLNNGTANGIKYERVERDTDEQFGNSENEHQDETYVDGPGSVLVNLLTSLRHLPPAMHSVLIVMALTWLSWFPFFLFDTDWMGREVYHGDPTGDSLHMELYDQGVREGALGLLLNSVVLGISSFLIEPMCQRMGARVVWALSNFTVFACMAGTAVISLMSLSDDKNGIEYIMRGNETTRTAAVIVFALLGFPLAITYSVPFSVTAEVTADSGGGQGLAIGVLNLAIVIPQMIVSLGAGPWDQLFGGGNLPAFVLASVAAFAAGVIALQRLPTLSSSFKSTGFHIG DF075A3601299DA0 suc4_arath Sucrose transport protein SUC4 Sucrose permease 4 Sucrose-proton symporter 4 Sucrose transporter 4 SUC4 SUT4 F21M12.35 At1g09960 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATSDQDRRHRVTRNRPPIARPSTSSSRPVVSPPRSKVSKRVLLRVASVACGIQFGWALQLSLLTPYVQELGIPHAWASVIWLCGPLSGLFVQPLVGHSSDRCTSKYGRRRPFIVAGAVAISISVMVIGHAADIGWAFGDREGKIKPRAIVAFVLGFWILDVANNMTQGPCRALLADLTENDNRRTRVANGYFSLFMAVGNVLGYATGSYNGWYKIFTFTKTVACNVECANLKSAFYIDVVFIAITTILSVSAAHEVPLASLASEAHGQTSGTDEAFLSEIFGTFRYFPGNVWIILLVTALTWIGWFPFILFDTDWMGREIYGGEPNIGTSYSAGVSMGALGLMLNSVFLGITSVLMEKLCRKWGAGFVWGISNILMAICFLGMIITSFVASHLGYIGHEQPPASIVFAAVLIFTILGIPLAITYSVPYALISIRIESLGLGQGLSLGVLNLAIVIPQVIVSVGSGPWDQLFGGGNSPALAVGAATGFIGGIVAILALPRTRIQKPIPLP 3AF99CF2D48ACBD4 suc2-sut2 1 3 unspecified role unspecified role prey prey n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role bait bait c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 3 Both AtSUT2 as well as AtSUC2 were able to interact with themselves and with NubG-fusions of sucrose transporters AtSUT2, AtSUC2, and AtSUT4, but not with soluble NubG alone suc2-suc2 1 2 unspecified role unspecified role bait bait c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 2 unspecified role unspecified role prey prey n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3 Both AtSUT2 as well as AtSUC2 were able to interact with themselves and with NubG-fusions of sucrose transporters AtSUT2, AtSUC2, and AtSUT4, but not with soluble NubG alone suc2-sut4 1 2 unspecified role unspecified role bait bait c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3 Both AtSUT2 as well as AtSUC2 were able to interact with themselves and with NubG-fusions of sucrose transporters AtSUT2, AtSUC2, and AtSUT4, but not with soluble NubG alone sut2-sut4-1 1 3 unspecified role unspecified role bait bait c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3 Both AtSUT2 as well as AtSUC2 were able to interact with themselves and with NubG-fusions of sucrose transporters AtSUT2, AtSUC2, and AtSUT4, but not with soluble NubG alone sut2-1 1 3 unspecified role unspecified role bait bait c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role prey prey n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3 Both AtSUT2 as well as AtSUC2 were able to interact with themselves and with NubG-fusions of sucrose transporters AtSUT2, AtSUC2, and AtSUT4, but not with soluble NubG alone sut2-suc2-1 1 2 unspecified role unspecified role prey prey n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role bait bait c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 3 Both AtSUT2 as well as AtSUC2 were able to interact with themselves and with NubG-fusions of sucrose transporters AtSUT2, AtSUC2, and AtSUT4, but not with soluble NubG alone