IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ In vivo interaction between NPR1 and transcription factor TGA2 leads to salicylic acid-mediated gene activation in Arabidopsis. In vivo interaction between NPR1 and transcription factor TGA2 leads to salicylic acid-mediated gene activation in Arabidopsis. Plant Cell (1040-4651) 2002 imex curation Fan W., Dong X. xdong@duke.edu; 22-Jan-2008: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa tag visualisation tag visualisation Fan W., Dong X. xdong@duke.edu; Accepted 2007-DEC-19 by JYOTI. 22-Jan-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2002 Only protein-protein interactions imex curation In vivo interaction between NPR1 and transcription factor TGA2 leads to salicylic acid-mediated gene activation in Arabidopsis. In vivo interaction between NPR1 and transcription factor TGA2 leads to salicylic acid-mediated gene activation in Arabidopsis. Plant Cell (1040-4651) 2002 imex curation Fan W., Dong X. xdong@duke.edu; 22-Jan-2008: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Fan W., Dong X. xdong@duke.edu; Accepted 2007-DEC-19 by JYOTI. Plant Cell (1040-4651) 2002 Only protein-protein interactions imex curation npr1_arath Regulatory protein NPR1 SAI1 BTB/POZ domain-containing protein NPR1 NPR1 NIM1 At1g64280 F15H21.6 Nonexpresser of PR genes 1 Non-inducible immunity protein 1 Salicylic acid insensitive 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTTIDGFADSYEISSTSFVATDNTDSSIVYLAAEQVLTGPDVSALQLLSNSFESVFDSPDDFYSDAKLVLSDGREVSFHRCVLSARSSFFKSALAAAKKEKDSNNTAAVKLELKEIAKDYEVGFDSVVTVLAYVYSSRVRPPPKGVSECADENCCHVACRPAVDFMLEVLYLAFIFKIPELITLYQRHLLDVVDKVVIEDTLVILKLANICGKACMKLLDRCKEIIVKSNVDMVSLEKSLPEELVKEIIDRRKELGLEVPKVKKHVSNVHKALDSDDIELVKLLLKEDHTNLDDACALHFAVAYCNVKTATDLLKLDLADVNHRNPRGYTVLHVAAMRKEPQLILSLLEKGASASEATLEGRTALMIAKQATMAVECNNIPEQCKHSLKGRLCVEILEQEDKREQIPRDVPPSFAVAADELKMTLLDLENRVALAQRLFPTEAQAAMEIAEMKGTCEFIVTSLEPDRLTGTKRTSPGVKIAPFRILEEHQSRLKALSKTVELGKRFFPRCSAVLDQIMNCEDLTQLACGEDDTAEKRLQKKQRYMEIQETLKKAFSEDNLELGNSSLTDSTSSTSKSTGGKRSNRKLSHRRR DIP protein P93002 original sequence version: 106 DDD618146254CD68 tga2_arath Transcription factor TGA2 TGA2 BZIP20 HBP1B At5g06950 MOJ9.12 HBP-1b homolog bZIP transcription factor 20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSPRTDVSTDDDTDHPDLGSEGALVNTAASDSSDRSKGKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISGTGDQAHSTGGNGALAFDAEHSRWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDYFSRLRALSSLWLARPRE D3033153BCE932C4 as_1-arath-dna As-1 element oligonucleotide dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid in vitro In vitro CTAGCGGAGGACTGTCCTCCG 8BBA5AC860046364 tga2-npr1 2 3 unspecified role unspecified role prey prey P93002:p.Cys150Tyr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C Y Wed May 02 16:25:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys150tyr' Tue Jun 30 18:28:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys150Tyr' 4 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain arath-leaf Arabidopsis thaliana leaf leaf leaf physical association physical association 1, 3C, 3D These results clearly indicate that TGA2CT and NPR1 form a complex in wild-type plants resulting in the dominant-negative effect of TGA2CT, and this complex is disrupted in the npr1-2 mutant, abolishing the dominantnegative effect The authors state "In the SA-treated sample, a noticeable increase in NPR1 was observed in the eluate, indicating that SA either enhances the NPR1-TGA2 interaction or, through an unknown mechanism, makes NPR1 more available for binding to TGA2." 24 hour treatment of 1 mM SA. tga2-as_1 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath-leaf Arabidopsis thaliana leaf leaf leaf direct interaction direct interaction 1 The TGA2CT mutant could no longer bind to the as-1 element, as demonstrated by a gel mobility shift assay The oligonucleotide was end radiolabelled with 32P