UniProt UniProt http://www.uniprot.org Molecular effects of Eya1 domain mutations causing organ defects in BOR syndrome. Molecular effects of Eya1 domain mutations causing organ defects in BOR syndrome. Hum. Mol. Genet. (0964-6906) 2001 Buller C., Xu X., Marquis V., Schwanke R., Xu PX. pxu@po.mri.montana.edu 07-Aug-2007: Contacted by JYOTI. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Buller C., Xu X., Marquis V., Schwanke R., Xu PX. pxu@po.mri.montana.edu Accepted 2007-AUG-25 by JYOTI. Hum. Mol. Genet. (0964-6906) 2001 Molecular effects of Eya1 domain mutations causing organ defects in BOR syndrome. Molecular effects of Eya1 domain mutations causing organ defects in BOR syndrome. Hum. Mol. Genet. (0964-6906) 2001 Buller C., Xu X., Marquis V., Schwanke R., Xu PX. pxu@po.mri.montana.edu 07-Aug-2007: Contacted by JYOTI. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Buller C., Xu X., Marquis V., Schwanke R., Xu PX. Nuclear extracts of 293 cells co-transfected with Six1- and Eya1- expression plasmids have been used. pxu@po.mri.montana.edu Accepted 2007-AUG-25 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Hum. Mol. Genet. (0964-6906) 2001 eya1_mouse Eyes absent homolog 1 Eya1 protein protein mouse Mus musculus Mouse MEMQDLTSPHSRLSGSSESPSGPKLDSSHINSTSMTPNGTEVKTEPMSSSEIASTAADGSLDSFSGSALGSSSFSPRPAHPFSPPQIYPSKSYPHILPTPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTESGLSQSQSPGQTGFLSYGTSFGTPQPGQAPYSYQMQGSSFTTSSGLYSGNNSLTNSSGFNSSQQDYPSYPGFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGVTSQAVTDPTAEYSTIHSPSTPIKETDSERLRRGSDGKSRGRGRRNNNPSPPPDSDLERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSANLCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRVSSHSDLMALHHALELEYL D31F71852FBDC76C six1_mouse Homeobox protein SIX1 Six1 Sine oculis homeobox homolog 1 protein protein mouse Mus musculus Mouse MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQSNMGHARSSNYSLPGLTASQPSHGLQAHQHQLQDSLLGPLTSSLVDLGS 4A6F88000FB9F8EB six2_mouse Homeobox protein SIX2 Six2 Sine oculis homeobox homolog 2 protein protein mouse Mus musculus Mouse MSMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENSENSNSSSHNPLASSLNGSGKSVLGSSEDEKTPSGTPDHSSSSPALLLSPPPPPGLPSLHSLGHPPGPSAVPVPVPGGGGADPLQHHHSLQDSILNPMSANLVDLGS 0FFAB002014D8E60 eya1-six1-1 1 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P97767:p.Ser486Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S P Wed May 02 20:14:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser486pro' Tue Jun 30 20:18:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser486Pro' eya1_domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P97767:p.Glu330Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E K Wed May 02 19:32:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu330lys' Tue Jun 30 18:08:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu330Lys' P97767:p.Leu504Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L R Wed May 02 18:12:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu504arg' Tue Jun 30 18:03:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu504Arg' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction 1B eya1-six2-1 1 3 unspecified role unspecified role bait bait P97767:p.Leu504Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L R Wed May 02 20:09:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu504arg' Tue Jun 30 19:39:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu504Arg' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P97767:p.Ser486Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S P Wed May 02 17:59:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser486pro' Tue Jun 30 17:24:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser486Pro' eya1_domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P97767:p.Glu330Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E K Wed May 02 18:53:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu330lys' Tue Jun 30 15:48:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu330Lys' P97767:p.Gly425Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G S Wed May 02 18:38:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly425ser' Tue Jun 30 16:23:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly425Ser' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction 1B eya1-six1-2 2 4 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 3 unspecified role unspecified role bait bait eya1_domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P97767:p.Glu330Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E K Wed May 02 19:47:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu330lys' Tue Jun 30 17:03:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu330Lys' P97767:p.Ser486Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S P Wed May 02 20:14:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser486pro' Tue Jun 30 18:24:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser486Pro' P97767:p.Leu504Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L R Wed May 02 16:08:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu504arg' Tue Jun 30 18:00:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu504Arg' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 2C, 3B, 3C Similar results have been obtained for using full length Eya1 or Eya1-domain fragment both with the respective mutations. eya1-six2-2 2 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 3 unspecified role unspecified role bait bait eya1_domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 2C, 3B, 3C Eya1 mutations glu330lys, ser454pro and leu472arg did not affect the interaction.