UniProt UniProt http://www.uniprot.org Conserved Wat1/Pop3 WD-repeat protein of fission yeast secures genome stability through microtubule integrity and may be involved in mRNA maturation. Conserved Wat1/Pop3 WD-repeat protein of fission yeast secures genome stability through microtubule integrity and may be involved in mRNA maturation. J. Cell. Sci. (0021-9533) 2001 imex curation Ochotorena IL., Hirata D., Kominami K., Potashkin J., Sahin F., Wentz-Hunter K., Gould KL., Sato K., Yoshida Y., Vardy L., Toda T. toda@icrf.icnet.uk 01-Feb-2008: Contacted by JYOTI. An S. pombe genomic cDNA library was used. Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ochotorena IL., Hirata D., Kominami K., Potashkin J., Sahin F., Wentz-Hunter K., Gould KL., Sato K., Yoshida Y., Vardy L., Toda T. toda@icrf.icnet.uk Accepted 2008-FEB-21 by CDEROW. 01-Feb-2008: Contacted by JYOTI. An S. pombe genomic cDNA library was used. J. Cell. Sci. (0021-9533) 2001 Only protein-protein interactions imex curation Conserved Wat1/Pop3 WD-repeat protein of fission yeast secures genome stability through microtubule integrity and may be involved in mRNA maturation. Conserved Wat1/Pop3 WD-repeat protein of fission yeast secures genome stability through microtubule integrity and may be involved in mRNA maturation. J. Cell. Sci. (0021-9533) 2001 imex curation Ochotorena IL., Hirata D., Kominami K., Potashkin J., Sahin F., Wentz-Hunter K., Gould KL., Sato K., Yoshida Y., Vardy L., Toda T. toda@icrf.icnet.uk 01-Feb-2008: Contacted by JYOTI. An S. pombe genomic cDNA library was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ochotorena IL., Hirata D., Kominami K., Potashkin J., Sahin F., Wentz-Hunter K., Gould KL., Sato K., Yoshida Y., Vardy L., Toda T. toda@icrf.icnet.uk Accepted 2008-FEB-21 by CDEROW. 01-Feb-2008: Contacted by JYOTI. An S. pombe genomic cDNA library was used. J. Cell. Sci. (0021-9533) 2001 Only protein-protein interactions imex curation Conserved Wat1/Pop3 WD-repeat protein of fission yeast secures genome stability through microtubule integrity and may be involved in mRNA maturation. Conserved Wat1/Pop3 WD-repeat protein of fission yeast secures genome stability through microtubule integrity and may be involved in mRNA maturation. J. Cell. Sci. (0021-9533) 2001 imex curation Ochotorena IL., Hirata D., Kominami K., Potashkin J., Sahin F., Wentz-Hunter K., Gould KL., Sato K., Yoshida Y., Vardy L., Toda T. toda@icrf.icnet.uk 01-Feb-2008: Contacted by JYOTI. An S. pombe genomic cDNA library was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ochotorena IL., Hirata D., Kominami K., Potashkin J., Sahin F., Wentz-Hunter K., Gould KL., Sato K., Yoshida Y., Vardy L., Toda T. toda@icrf.icnet.uk Accepted 2008-FEB-21 by CDEROW. 01-Feb-2008: Contacted by JYOTI. An S. pombe genomic cDNA library was used. J. Cell. Sci. (0021-9533) 2001 Only protein-protein interactions imex curation Conserved Wat1/Pop3 WD-repeat protein of fission yeast secures genome stability through microtubule integrity and may be involved in mRNA maturation. Conserved Wat1/Pop3 WD-repeat protein of fission yeast secures genome stability through microtubule integrity and may be involved in mRNA maturation. J. Cell. Sci. (0021-9533) 2001 imex curation Ochotorena IL., Hirata D., Kominami K., Potashkin J., Sahin F., Wentz-Hunter K., Gould KL., Sato K., Yoshida Y., Vardy L., Toda T. toda@icrf.icnet.uk 01-Feb-2008: Contacted by JYOTI. An S. pombe genomic cDNA library was used. Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ochotorena IL., Hirata D., Kominami K., Potashkin J., Sahin F., Wentz-Hunter K., Gould KL., Sato K., Yoshida Y., Vardy L., Toda T. toda@icrf.icnet.uk Accepted 2008-FEB-21 by CDEROW. 01-Feb-2008: Contacted by JYOTI. An S. pombe genomic cDNA library was used. J. Cell. Sci. (0021-9533) 2001 Only protein-protein interactions imex curation u2af2_schpo Splicing factor U2AF 59 kDa subunit U2 auxiliary factor 59 kDa subunit U2 snRNP auxiliary factor large subunit prp2 mis11 SPBC146.07 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDLSSRLSSGSSRIPKRHRDYRDEEPRRERGSGGIGREDPRGHYGSERPRRRRRDESDFRRHRESRERSYREDERPRRERRYDDYEPRSLRYSSVGRSRSPPPSRERSVRSIEQELEQLRDVTPINQWKRKRSLWDIKPPGYELVTADQAKMSGVFPLPGAPRAAVTDPEKLLEFARSAEGSIIAPPPPLQPGASRQARRLVVTGIPNEFVEDAFVSFIEDLFISTTYHKPETKHFSSVNVCKEENFAILEVATPEDATFLWGLQSESYSNDVFLKFQRIQNYIVPQITPEVSQKRSDDYAKNDVLDSKDKIYISNLPLNLGEDQVVELLKPFGDLLSFQLIKNIADGSSKGFCFCEFKNPSDAEVAISGLDGKDTYGNKLHAQFACVGLNQAMIDKSNGMAILTELAKASSQSIPTRVLQLHNLITGDEIMDVQEYEDIYESVKTQFSNYGPLIDIKIPRSIGTRNSGLGTGKVFVRYSDIRSAEVAMEEMKGCKFNDRTIVIAFYGEDCYKANAW B2E53EF633184731 uap2_schpo Splicing factor U2AF-associated protein 2 uap2 SPBC1289.02c Cold sensitive U2 snRNA suppressor 2 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSQPFWDERIHRWRCLGSEGNELIYIDEEQTWKDYDPNSLKMNKAGSTGAEVSDVTAEATEGKESSNGEDRHTKRLYESTSAEGYPSGSRNKKSKSENSEASPAPVINKAVYIQGLPLDVTVDEIEEVFKKCGVIAKNIDNGTPRIKIYRTEDGTPKGDALIVFFRSESVELAEQLFDDTEFRYGSGQKMRVQKANIDYKKEKTVNKDVGGALKKKALRLRQQQMQQISSWDDVDEEVDDKRKKRFNKIVVLKHIFTLEELDKTPELLIDLKDDITEEAEKCGRVTNVVLYDKEPDGVVTVRFSNNEEAEACVRLMQGRYFDGRVVEASIYDGKVRFQKSGKHTLDDEEDEEKRLEKFADWLENSN AAA72B803E5AABC9 wat1_schpo Target of rapamycin complex subunit wat1 pop3 WD repeat-containing protein pop3 wat1 SPBC21B10.05c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSVQYPPQHSVLLVSSGYDHTIRFWEALSGICSRTIQHADSQVNRLCISPDKKFLAAAGNPHVRLYDINTSSQMPLMTFEGHTNNVTAIAFHCDGKWLATSSEDGTVKVWDMRAPSVQRNYDHKSPVNDLLIHPNQGELLSCDQSGRVRAWDLGENSCTHELIPEEDVPMSSITVGSDGSMLIAGNNKGNCYVWRMLNHQGASLLQPVVKFQAHQRYITRCVLSPDVKHLATCSADATVNIWSTEDMSFMLERRLQGHQRWVWDCAFSADSTYLVTASSDHVARLWELSSGETIRQYSGHHKAAVCVALNDYQI DC6D1275BDF1E086 u2af1_schpo Splicing factor U2AF 23 kDa subunit U2 auxiliary factor 23 kDa subunit U2 snRNP auxiliary factor small subunit SPAP8A3.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MASHLASIYGTEQDKVNCSFYYKIGACRHGERCSRKHVKPNFSQTILCPNMYKNPIHEPNGKKFTQRELAEQFDAFYEDMFCEFSKYGEVEQLVVCDNVGDHLVGNVYVRFKYEESAQNAIDDLNSRWYSQRPVYAELSPVTDFREACCRQHETSECQRGGLCNFMHAKKPSPQLLRDLVLAQRKYLALNAAEEMKKEPNSDSTNRWVSVTAERKN AAEDD3DE2DF3507D prp2-pop3-1 2 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association prp2-u2af23-1 3 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Table 2 prp2-uap2-1 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Table 2 pop3-prp2-1 4 7 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey physical association physical association Fig 3A prp2-pop3-2 1 7 unspecified role unspecified role prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role bait bait physical association physical association Fig 3B prp2-pop3-3 3 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Table 2