UniProt UniProt http://www.uniprot.org Identification of a novel high affinity copper transport complex in the fission yeast Schizosaccharomyces pombe. Identification of a novel high affinity copper transport complex in the fission yeast Schizosaccharomyces pombe. J. Biol. Chem. (0021-9258) 2001 Zhou H., Thiele DJ. dthiele@umich.edu 22-Jan-2008: Contacted by JYOTI. orchard schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou H., Thiele DJ. dthiele@umich.edu Accepted 2007-Not a month!-10 by ORCHARD. J. Biol. Chem. (0021-9258) 2001 orchard ctr4_schpo Copper transport protein ctr4 ctr4 SPCC1393.10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSFFSAAKQSLGNSLIKLGTSMAQNSQGPVDDSSLSQLENLLPPLQILTARAAMAAMNMSNDTSMSGMNMTNSTTPMSGMNMTNSTTSMSGMNMSNSTTSMSGMNMTNTTTTAKASSCKLSMYWNWYTIDACFITKHWHITSKHMFVGSIFGIIFMMMALELVRRGQREFDRWCVRRFSPASNSCCHSGAPVHSGPSMALRIFLHFLRSCFYLVQYIVAYIAMLLAMYYNGYVILFLFCGTFFGYFLFGADTISTKASSSVQTKTIVQVADEKHEHDSSQYSDTTPTTE D6A07DF015B81322 ctr5_schpo Copper transport protein ctr5 ctr5 SPAC1142.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSLSKMSMSGMSGMGMGSSSNSSAATCRMSMLWNWYIHDSCFLAKSWHINTGNKFAGSIIGIFFFAVAIEGLSLVQRMFDRWIVAHSNGKTLSGPLRIFFPSSTVHVTVWQQLIRAAMYSSFYLSATILMLIVMSFNGYAILFGFVGAWIGFFLFASDTYGTPSTGTGCCESR 435BF087296B4E55 ctr4-ctr5-1 1 2 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 7B Immunoprecipitation of Ctr5-myc4 resulted in the co-immunoprecipitation of Ctr4-FLAG2 (Fig. 7B, top panel, lane 8) and immunoprecipitation of Ctr4-FLAG2 co-fractionated with Ctr5-myc4 (Fig. 7B, bottom panel, lane 8) ctr5-ctr4-1 1 2 unspecified role unspecified role prey prey c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role bait bait c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 7B Immunoprecipitation of Ctr5-myc4 resulted in the co-immunoprecipitation of Ctr4-FLAG2 (Fig. 7B, top panel, lane 8) and immunoprecipitation of Ctr4-FLAG2 co-fractionated with Ctr5-myc4 (Fig. 7B, bottom panel, lane 8)