IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Essential tyrosine residues for interaction of the non-receptor protein-tyrosine phosphatase PTP1B with N-cadherin. Essential tyrosine residues for interaction of the non-receptor protein-tyrosine phosphatase PTP1B with N-cadherin. J. Biol. Chem. (0021-9258) 2001 imex curation Rhee J., Lilien J., Balsamo J. Xu G et al 2002 JBC 277 49989-49997 describes the cDNA encoding the cytoplasmic (residues 752-912) domain of chick N-Cadherin. In a previous paper by the same authors (Balsamo et al J Cell Biol 1998 143 523-32) recombinant human PTP1B was used. janne-balsamo@uiowa.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Rhee J., Lilien J., Balsamo J. L cells stably expressing the wild type, constitutively active mouse N-cadherin (LN-cells) were used. janne-balsamo@uiowa.edu Accepted 2007-JUL-27 by JYOTI. 07-Aug-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation Essential tyrosine residues for interaction of the non-receptor protein-tyrosine phosphatase PTP1B with N-cadherin. Essential tyrosine residues for interaction of the non-receptor protein-tyrosine phosphatase PTP1B with N-cadherin. J. Biol. Chem. (0021-9258) 2001 imex curation Rhee J., Lilien J., Balsamo J. Xu G et al 2002 JBC 277 49989-49997 describes the cDNA encoding the cytoplasmic (residues 752-912) domain of chick N-Cadherin. In a previous paper by the same authors (Balsamo et al J Cell Biol 1998 143 523-32) recombinant human PTP1B was used. janne-balsamo@uiowa.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Rhee J., Lilien J., Balsamo J. L cells stably expressing the wild type, constitutively active mouse N-cadherin (LN-cells) were used. janne-balsamo@uiowa.edu Accepted 2007-JUL-27 by JYOTI. 07-Aug-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation Essential tyrosine residues for interaction of the non-receptor protein-tyrosine phosphatase PTP1B with N-cadherin. Essential tyrosine residues for interaction of the non-receptor protein-tyrosine phosphatase PTP1B with N-cadherin. J. Biol. Chem. (0021-9258) 2001 imex curation Rhee J., Lilien J., Balsamo J. Xu G et al 2002 JBC 277 49989-49997 describes the cDNA encoding the cytoplasmic (residues 752-912) domain of chick N-Cadherin. In a previous paper by the same authors (Balsamo et al J Cell Biol 1998 143 523-32) recombinant human PTP1B was used. janne-balsamo@uiowa.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rhee J., Lilien J., Balsamo J. L cells stably expressing the wild type, constitutively active mouse N-cadherin (LN-cells) were used. janne-balsamo@uiowa.edu Accepted 2007-JUL-27 by JYOTI. 07-Aug-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation Essential tyrosine residues for interaction of the non-receptor protein-tyrosine phosphatase PTP1B with N-cadherin. Essential tyrosine residues for interaction of the non-receptor protein-tyrosine phosphatase PTP1B with N-cadherin. J. Biol. Chem. (0021-9258) 2001 imex curation Rhee J., Lilien J., Balsamo J. Xu G et al 2002 JBC 277 49989-49997 describes the cDNA encoding the cytoplasmic (residues 752-912) domain of chick N-Cadherin. In a previous paper by the same authors (Balsamo et al J Cell Biol 1998 143 523-32) recombinant human PTP1B was used. janne-balsamo@uiowa.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro affinity techniques affinity technology affinity techniques predetermined predetermined participant predetermined Rhee J., Lilien J., Balsamo J. Xu G et al 2002 JBC 277 49989-49997 describes the cDNA encoding the cytoplasmic (residues 752-912) domain of chick N-Cadherin. In a previous paper by the same authors (Balsamo et al J Cell Biol 1998 143 523-32) recombinant human PTP1B was used. janne-balsamo@uiowa.edu Accepted 2007-JUL-27 by JYOTI. J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation cadh2_mouse Cadherin-2 Cdh2 Neural cadherin protein protein mouse Mus musculus Mouse MCRIAGAPRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLPKDVHEGQPLLNVKFSNCNRKRKVQYESSEPADFKVDEDGTVYAVRSFPLTAEQAKFLIYAQDKETQEKWQVAVNLSREPTLTEEPMKEPHEIEEIVFPRQLAKHSGALQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDVIVANLTVTDKDQPHTPAWNAAYRISGGDPTGRFAILTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTLTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPEPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTINRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRLDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGDQDYDYLNDWGPRFKKLADMYGGGDD DIP protein P15116 original sequence version: 114 DIP protein P15116 original sequence version: 105 DIP protein P15116 original sequence version: 125 DIP protein P15116 original sequence version: 113 DIP protein P15116 original sequence version: 117 DIP protein P15116 original sequence version: 147 BDAB8063A23E1F13 cadh2_chick Cadherin-2 Neural cadherin CDH2 protein protein chick Gallus gallus (Chicken) Chicken MCRIAGTPPRILPPLALMLLAALQQAPIKATCEDMLCKMGFPEDVHSAVVSRSVHGGQPLLNVRFQSCDENRKIYFGSSEPEDFRVGEDGVVYAERSFQLSAEPTEFVVSARDKETQEEWQMKVKLTPEPAFTGASEKDQKKIEDIIFPWQQYKDSSHLKRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKSLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIASFHLRAHAVDVNGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAQNGMLRYRILSQAPSSPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDVIVANLTVTDKDQPHTPAWNARYQMTGGDPTGQFTILTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSITVIDVNESPYFVPNPKLVRQEEGLLAGSMLTTFTARDPDRYMQQTSLRYSKLSDPANWLKIDPVNGQITTTAVLDRESIYVQNNMYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVNPKEATTCETLQPNAINITAVDPDIDPNAGPFAFELPDSPPSIKRNWTIVRISGDHAQLSLRIRFLEAGIYDVPIVITDSGNPHASSTSVLKVKVCQCDINGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRLDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD DIP protein P10288 original sequence version: 119 DIP protein P10288 original sequence version: 62 9BA5AC9DC1FFC489 ptn1_human Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B protein protein human Homo sapiens Human MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT DIP protein P18031 original sequence version: 141 DIP protein P18031 original sequence version: 191 802377DCD33F41FD ptn1-cdh2 4 7 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P18031:p.Cys215Ser mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:24:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys215ser' Tue Jun 30 18:28:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys215Ser' P18031:p.Tyr66Phe mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 19:12:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr66phe' Tue Jun 30 16:06:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr66Phe' P18031:p.Tyr153Phe mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:30:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr153phe' Tue Jun 30 18:35:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr153Phe' P18031:p.[Tyr66Phe;Tyr153Phe] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:39:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr66phe,tyr153phe' Tue Jun 30 19:20:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr66Phe;Tyr153Phe]' P18031:p.Tyr152Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 19:48:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr152phe' Tue Jun 30 20:20:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr152Phe' P18031:p.[Tyr66Phe;Tyr152Phe;Tyr153Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:20:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr66phe,tyr152phe,tyr153phe' Tue Jun 30 18:15:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr66Phe;Tyr152Phe;Tyr153Phe]' P18031:p.[Tyr66Phe;Tyr152Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 19:32:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr66phe,tyr152phe' Tue Jun 30 17:12:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr66Phe;Tyr152Phe]' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region n6btnlys N6-biotinyl-L-lysine (2S)-2-amino-6-(5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanoylamino)hexanoic acid (3aS-(3aalpha,4beta,6aalpha))-N6-(5-(hexahydro-2-oxo-1H-thieno(3,4-d)imidazol-4-yl)-1-oxopentyl)-L-lysine MOD_RES N6-biotinyllysine N6-[5-((3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl)-1-oxopentyl]-L-lysine N6-biotinyl-L-lysine N6-biotinyllysine biocytin epsilon-N-biotinyllysine Biotin Biotinylation N6BtnLys biotinyl lysyl undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 3 Optimal binding of PTP1B to immobilized N-cadherin depends on phosphorylated tyrosine residues. ptpn1-cdh2 2 7 unspecified role unspecified role bait bait P18031:p.Cys215Ser mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:10:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys215ser' Tue Jun 30 15:37:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys215Ser' P18031:p.Tyr152Phe mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:53:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr152phe' Tue Jun 30 18:22:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr152Phe' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey physical association physical association 4 A mutation at tyrosine residues 66 and 153 alone (Fig. 4A) or in combination (not shown) have no effect on binding of PTP1B to N-cadherin. cdh2-ptpn1 1 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey P18031:p.Tyr152Phe mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 19:38:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr152phe' Tue Jun 30 17:09:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr152Phe' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P18031:p.Cys215Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:33:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys215ser' Tue Jun 30 18:25:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys215Ser' physical association physical association 4 B Expression of the dominant-negative C215S mutant PTP1B in LN-cells prevents the association of endogenous PTP1B with N-cadherin P18031 transfection cdh2-ptpn1-1 3 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey cys215ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S Wed Jul 06 16:49:35 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'cys215ser' physical association physical association 4 B expression of PTP1B carrying both the C215S and the Y152F mutations does not alter the association of endogenous PTP1B with N-cadherin. Tyrosine 152 is critical for in situ binding and displacement of endogenous PTP1B from cadherin.