IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Heterocomplex formation between metastasis-related protein S100A4 (Mts1) and S100A1 as revealed by the yeast two-hybrid system. Heterocomplex formation between metastasis-related protein S100A4 (Mts1) and S100A1 as revealed by the yeast two-hybrid system. FEBS Lett. (0014-5793) 2000 Tarabykina S., Kriajevska M., Scott DJ., Hill TJ., Lafitte D., Derrick PJ., Dodson GG., Lukanidin E., Bronstein I. Cancer - Interactions investigated in the context of cancer svetlana@mcb.molbio.ku.dk 13-Nov-2007: Contacted by JYOTI. A mouse mammary adenocarcinoma cDNA library was used. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tarabykina S., Kriajevska M., Scott DJ., Hill TJ., Lafitte D., Derrick PJ., Dodson GG., Lukanidin E., Bronstein I. Cancer - Interactions investigated in the context of cancer svetlana@mcb.molbio.ku.dk Accepted 2007-NOV-17 by DAVET. A mouse mammary adenocarcinoma cDNA library was used. FEBS Lett. (0014-5793) 2000 davet Heterocomplex formation between metastasis-related protein S100A4 (Mts1) and S100A1 as revealed by the yeast two-hybrid system. Heterocomplex formation between metastasis-related protein S100A4 (Mts1) and S100A1 as revealed by the yeast two-hybrid system. FEBS Lett. (0014-5793) 2000 Tarabykina S., Kriajevska M., Scott DJ., Hill TJ., Lafitte D., Derrick PJ., Dodson GG., Lukanidin E., Bronstein I. Cancer - Interactions investigated in the context of cancer svetlana@mcb.molbio.ku.dk 13-Nov-2007: Contacted by JYOTI. A mouse mammary adenocarcinoma cDNA library was used. davet in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Tarabykina S., Kriajevska M., Scott DJ., Hill TJ., Lafitte D., Derrick PJ., Dodson GG., Lukanidin E., Bronstein I. Cancer - Interactions investigated in the context of cancer svetlana@mcb.molbio.ku.dk Accepted 2007-NOV-17 by DAVET. 13-Nov-2007: Contacted by JYOTI. A mouse mammary adenocarcinoma cDNA library was used. FEBS Lett. (0014-5793) 2000 davet Heterocomplex formation between metastasis-related protein S100A4 (Mts1) and S100A1 as revealed by the yeast two-hybrid system. Heterocomplex formation between metastasis-related protein S100A4 (Mts1) and S100A1 as revealed by the yeast two-hybrid system. FEBS Lett. (0014-5793) 2000 Tarabykina S., Kriajevska M., Scott DJ., Hill TJ., Lafitte D., Derrick PJ., Dodson GG., Lukanidin E., Bronstein I. Cancer - Interactions investigated in the context of cancer svetlana@mcb.molbio.ku.dk 13-Nov-2007: Contacted by JYOTI. A mouse mammary adenocarcinoma cDNA library was used. davet in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Tarabykina S., Kriajevska M., Scott DJ., Hill TJ., Lafitte D., Derrick PJ., Dodson GG., Lukanidin E., Bronstein I. Cancer - Interactions investigated in the context of cancer For the electrospray ionization Fourier transform ion cyclotron resonance (ESI-FTICR) mass spectrometry, measurements were made using a FTICR mass spectrometer (Bruker Daltonics). svetlana@mcb.molbio.ku.dk Accepted 2007-NOV-17 by DAVET. 13-Nov-2007: Contacted by JYOTI. A mouse mammary adenocarcinoma cDNA library was used. FEBS Lett. (0014-5793) 2000 davet Heterocomplex formation between metastasis-related protein S100A4 (Mts1) and S100A1 as revealed by the yeast two-hybrid system. Heterocomplex formation between metastasis-related protein S100A4 (Mts1) and S100A1 as revealed by the yeast two-hybrid system. FEBS Lett. (0014-5793) 2000 Tarabykina S., Kriajevska M., Scott DJ., Hill TJ., Lafitte D., Derrick PJ., Dodson GG., Lukanidin E., Bronstein I. Cancer - Interactions investigated in the context of cancer svetlana@mcb.molbio.ku.dk 13-Nov-2007: Contacted by JYOTI. A mouse mammary adenocarcinoma cDNA library was used. davet in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Tarabykina S., Kriajevska M., Scott DJ., Hill TJ., Lafitte D., Derrick PJ., Dodson GG., Lukanidin E., Bronstein I. Cancer - Interactions investigated in the context of cancer The presence of the unique tryptophan residue (W90) in the C-terminus of S100A1 allowed use of fluorescence spectrometry to monitor the S100A1^S100A4 interaction by changes in tryptophan fluorescence. svetlana@mcb.molbio.ku.dk Accepted 2007-NOV-17 by DAVET. 13-Nov-2007: Contacted by JYOTI. A mouse mammary adenocarcinoma cDNA library was used. FEBS Lett. (0014-5793) 2000 davet Heterocomplex formation between metastasis-related protein S100A4 (Mts1) and S100A1 as revealed by the yeast two-hybrid system. Heterocomplex formation between metastasis-related protein S100A4 (Mts1) and S100A1 as revealed by the yeast two-hybrid system. FEBS Lett. (0014-5793) 2000 Tarabykina S., Kriajevska M., Scott DJ., Hill TJ., Lafitte D., Derrick PJ., Dodson GG., Lukanidin E., Bronstein I. Cancer - Interactions investigated in the context of cancer svetlana@mcb.molbio.ku.dk 13-Nov-2007: Contacted by JYOTI. A mouse mammary adenocarcinoma cDNA library was used. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tarabykina S., Kriajevska M., Scott DJ., Hill TJ., Lafitte D., Derrick PJ., Dodson GG., Lukanidin E., Bronstein I. Cancer - Interactions investigated in the context of cancer svetlana@mcb.molbio.ku.dk Accepted 2007-NOV-17 by DAVET. 13-Nov-2007: Contacted by JYOTI. A mouse mammary adenocarcinoma cDNA library was used. FEBS Lett. (0014-5793) 2000 davet s10a1_mouse Protein S100-A1 S100a1 S-100 protein subunit alpha S-100 protein alpha chain S100 calcium-binding protein A1 protein protein mouse Mus musculus Mouse MGSELESAMETLINVFHAHSGQEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS 6060736751C4ED15 s10a4_mouse Protein S100-A4 S100a4 Capl Mts1 S100 calcium-binding protein A4 Metastasin Protein Mts1 Metastatic cell protein Placental calcium-binding protein Protein 18A2 PEL98 protein protein mouse Mus musculus Mouse MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK 2302254B67A4C873 s100a4-s100a1 5 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait P07091:p.Phe72Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 14:29:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe72ala' Tue Jun 30 16:26:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe72Ala' P07091:p.[Cys76Ser;Cys81Ser;Cys86Ser;Cys93Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:23:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys76ser,cys81ser,cys86ser,cys93ser' Tue Jun 30 16:06:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys76Ser;Cys81Ser;Cys86Ser;Cys93Ser]' P07091:p.[Cys76Ser;Cys81Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:06:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys76ser,cys81ser' Tue Jun 30 17:23:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys76Ser;Cys81Ser]' P07091:p.Cys76Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:09:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys76ser' Tue Jun 30 20:16:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys76Ser' leu79 binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Forty out of 41 clones were identified as the S100A4 cDNA fused in-frame with GAL4-AD, indicating the homodimerization of S100A4 in vivo. Besides the S100A4 dimers, one of the clones was identified as a cDNA encoding the S100A1 protein. Table 1 s100a4-s100a4 1 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Forty out of 41 clones were identified as the S100A4 cDNA fused in-frame with GAL4-AD, indicating the homodimerization of S100A4 in vivo. s100a4-s100a4-1 5 7 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait P07091:p.Phe72Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 19:12:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe72ala' Tue Jun 30 19:26:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe72Ala' leu79 binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 s100a4-s100a4-2 2 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association 1 A An attempt was made to demonstrate homo- and heterodimerization of S100A4 and S100A1 by anion-exchange chromatography. Purified preparations of S100A4 and S100A1 were mixed and incubated without denaturation, then concentrated and fractionated on a Resource Q column. Several distinct peaks were detected (Fig. 1A). Two of them eluting at 50 mM NaCl and 180 mM NaCl were shown to be the S100A4 and S100A1 homodimers, respectively. s100a1-s100a4-1 2 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association 1 A An attempt was made to demonstrate homo- and heterodimerization of S100A4 and S100A1 by anion-exchange chromatography. Purified preparations of S100A4 and S100A1 were mixed and incubated without denaturation, then concentrated and fractionated on a Resource Q column. Several distinct peaks were detected (Fig. 1A). Two of them eluting at 50 mM NaCl and 180 mM NaCl were shown to be the S100A4 and S100A1 homodimers, respectively. The intermediate peak was very small and contained both S100A4 and S100A1 proteins. s100a1-s100a1-6 2 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association 1 A An attempt was made to demonstrate homo- and heterodimerization of S100A4 and S100A1 by anion-exchange chromatography. Purified preparations of S100A4 and S100A1 were mixed and incubated without denaturation, then concentrated and fractionated on a Resource Q column. Several distinct peaks were detected (Fig. 1A). Two of them eluting at 50 mM NaCl and 180 mM NaCl were shown to be the S100A4 and S100A1 homodimers, respectively. s100a1-s100a4-2 3 6 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Direct evidence for the S100A4/S100A1 heterodimerization was obtained in vitro by ESI-FTICR mass spectrometry. MW = 24 982.00 Da 2 s100a4-s100a4-3 3 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction 2 Signals corresponding to non-covalent homodimeric complexes of both S100A1 and S100A4 were also observed s100a1-s100a1-7 3 6 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction 2 Signals corresponding to non-covalent homodimeric complexes of both S100A1 and S100A4 were also observed s100a1-s100a4-3 4 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association 3 The results indicate that this complex forms in the presence and in the absence of calcium, suggesting that the mechanism of the S100A4/ S100A1 heterodimerization could be di�erent from that of the homodimerization of S100A4. s100a4-s100a1-2 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Forty out of 41 clones were identified as the S100A4 cDNA fused in-frame with GAL4-AD, indicating the homodimerization of S100A4 in vivo. Besides the S100A4 dimers, one of the clones was identified as a cDNA encoding the S100A1 protein.