IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of drosophila bicoid-interacting proteins using a custom two-hybrid selection. Identification of drosophila bicoid-interacting proteins using a custom two-hybrid selection. Gene (0378-1119) 2000 imex curation Zhu W., Hanes SD. Chromatin - Epigenetic interactions resulting in chromatin modulation The interaction was measured by scoring for lys-independent growth and by assaying beta-galactosidase activity. Bicoid gene activates the reporter genes carrying closely spaced sites, hence a wide site spaced reporter construct with Bicoid binding sites spaced 25 bp apart was used. hanes@wadsworth.org 02-MAR-2006: Contacted by JYOTI. 0�12 h Drosophila embryonic cDNA library Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhu W., Hanes SD. Chromatin - Epigenetic interactions resulting in chromatin modulation The interaction was measured by scoring for lys-independent growth and by assaying beta-galactosidase activity. Bicoid gene activates the reporter genes carrying closely spaced sites, hence a wide site spaced reporter construct with Bicoid binding sites spaced 25 bp apart was used. hanes@wadsworth.org Accepted 2007-FEB-21 by DAVET. 02-MAR-2006: Contacted by JYOTI. 0�12 h Drosophila embryonic cDNA library Gene (0378-1119) 2000 Only protein-protein interactions imex curation Identification of drosophila bicoid-interacting proteins using a custom two-hybrid selection. Identification of drosophila bicoid-interacting proteins using a custom two-hybrid selection. Gene (0378-1119) 2000 imex curation Zhu W., Hanes SD. Chromatin - Epigenetic interactions resulting in chromatin modulation The interaction was measured by scoring for lys-independent growth and by assaying beta-galactosidase activity. Bicoid gene activates the reporter genes carrying closely spaced sites, hence a wide site spaced reporter construct with Bicoid binding sites spaced 25 bp apart was used. hanes@wadsworth.org 02-MAR-2006: Contacted by JYOTI. 0�12 h Drosophila embryonic cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhu W., Hanes SD. Chromatin - Epigenetic interactions resulting in chromatin modulation The interaction was measured by scoring for lys-independent growth and by assaying beta-galactosidase activity. Bicoid gene activates the reporter genes carrying closely spaced sites, hence a wide site spaced reporter construct with Bicoid binding sites spaced 25 bp apart was used. hanes@wadsworth.org Accepted 2007-FEB-21 by DAVET. 02-MAR-2006: Contacted by JYOTI. 0�12 h Drosophila embryonic cDNA library Gene (0378-1119) 2000 Only protein-protein interactions imex curation Identification of drosophila bicoid-interacting proteins using a custom two-hybrid selection. Identification of drosophila bicoid-interacting proteins using a custom two-hybrid selection. Gene (0378-1119) 2000 imex curation Zhu W., Hanes SD. Chromatin - Epigenetic interactions resulting in chromatin modulation The interaction was measured by scoring for lys-independent growth and by assaying beta-galactosidase activity. Bicoid gene activates the reporter genes carrying closely spaced sites, hence a wide site spaced reporter construct with Bicoid binding sites spaced 25 bp apart was used. hanes@wadsworth.org 02-MAR-2006: Contacted by JYOTI. 0�12 h Drosophila embryonic cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu W., Hanes SD. Chromatin - Epigenetic interactions resulting in chromatin modulation The interaction was measured by scoring for lys-independent growth and by assaying beta-galactosidase activity. Bicoid gene activates the reporter genes carrying closely spaced sites, hence a wide site spaced reporter construct with Bicoid binding sites spaced 25 bp apart was used. hanes@wadsworth.org Accepted 2007-FEB-21 by DAVET. 02-MAR-2006: Contacted by JYOTI. 0�12 h Drosophila embryonic cDNA library Gene (0378-1119) 2000 Only protein-protein interactions imex curation mepce_drome 7SK snRNA methylphosphate capping enzyme bin3 bin3 Bicoid-interacting protein 3 CG8276 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEKRLSDSPGDCRVTRSTMTPTLRLDQTSRQEPLPQQPDNGPAAAPGKSKSPTPLPGKSQAAQHHQFRAPQQQQGPKNRNKAWSKRQHKAGGKHNPSACVGASSGQAQSTGSSVIAATLLPTAASAHKADLENIQNIHNKNLTAGGGVNHHGNAGTAHHGGGGGAGAHHAAAGGHHHHHNTRLAQNAAAGGASGGGTIQMHKKMLRGHHHHVLCAGNNANHTCCLVTGCNGSSIGGVGVAGSGGATASAGGGGASCKEAQSCKDTSSLSGNSSIAGSAGAGNAVHYCCGRSKFFLPEKRLRKEVIVPPTKFLLGGNISDPLNLNSLQNENTSNASSTNNTPATTPRQSPITTPPKVEVIIPPNIHDPLHLLDPVDSMEYEKQLTSPMKRAGPGGGMLHHRQHHYRTRKNRKRRRFDSNNTSHAGDEGGVGSELTDEPPLPAATSSLAASPVAAPLNVGGSLLLSESAAPAPGETAEMGQQQEQAHVHSPQSASTTTTAAEMPTPTPTSAAAATATAEHKEQSAPAPTATSSPQRQQQHVAAAAEELPTPETSAAAETPAEEMLLSCSATSASLVASTLAERRASRDLRLDLSSTCYGVGGTGLSFGGSISSSVGSSFGGGGRKRKISESSTSQKSKKFHRHDAMDKIVSPVVPQPGAWKRPPRILQPSGARKPSTRRSTSVSESELLSPVEEQPPKQLPLIGVEIPRDDTPDLPDHGLGSPLSTTSGATSHTAGEQDSLAGVDISMGDTLGSGVVGKAPLTSSLMLEPAKIPPIKMLPKFRADGLKYRYGNFDRYVDFRQMNEFRDVRLQVFQRHVELFENKDILDIGCNVGHMTITVARHLAPKTIVGIDIDRELVARARRNLSIFVRIPKEEKLLEVKAEPTVDAKANIAVKDETSGAAHKKTRRGKRRRKVHQGIHHHHHHHHDLEQLQQQQKLNSLLVKPHEFFPISFPLTYGRIPRILSSSKSPNMLGNKNQFPANVFFRHTNYVLKDESLMASDTQQYDLILCLSVTKWIHLNFGDNGLKMAFKRMFNQLRPGGKLILEAQNWASYKKKKNLTPEIYNNYKQIEFFPNKFHEYLLSSEVGFSHSYTLGVPRHMNKGFCRPIQLYAKGDYTPNHVRWSDAYYPQTPYEAYRGIYATLPVHRMGGGGSSAGGSNSGHAQMLHLSSSSRSQNYDTPHYAGSASGSASCRQTPMYQPTYNPLETDSYQPSYDMEYLNHMYVFASPLYQTVWSPPASLRKSSSHTPVFGSVRDAELDGDGSGGGGSGGGSYHRHVYPPNDDTCSPNANACNAFNSIRDADTDDSNQLPGGSRRHVYATNCGESSSSPQVNHHDAVGEFVDGLMDDEQKSSTGGGTGGAAYCDLSDA FA3EDD8FDAA7A551 bcd_drome Homeotic protein bicoid bcd CG1034 PRD-4 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAQPPPDQNFYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQANRHMHMQYPSGGGPGPGSTNVNGGQFFQQQQVHNHQQQLHHQGNHVPHQMQQQQQQAQQQQYHHFDFQQKQASACRVLVKDEPEADYNFNSSYYMRSGMSGATASASAVARGAASPGSEVYEPLTPKNDESPSLCGIGIGGPCAIAVGETEAADDMDDGTSKKTTLQILEPLKGLDKSCDDGSSDDMSTGIRALAGTGNRGAAFAKFGKPSPPQGPQPPLGMGGVAMGESNQYQCTMDTIMQAYNPHRNAAGNSQFAYCFN 561D8509D5C11FD3 bcd-bin3 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score ++; 22.5 beta gal units 1B, table 1 Using a 0�12 h Drosophila embryonic cDNA library, four clones were identified; Bin1�Bin4 bcd-bin3-1 3 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 4A Two-hybrid mapping of the Bicoid-interacting domain of Bin3. Region AA 61-948 of Bin3 interacts most strongly with Bicoid. bcd-bin1-1 2 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score +; 150 beta gal units 1B, table 1 Using a 0�12 h Drosophila embryonic cDNA library, four clones were identified; Bin1�Bin4 for (Bicoid-Interacting protein 1�4). bin3-bcd 1 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 4B GST�Bin3 interacts with Bicoid.