IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Direct interaction of two homeoproteins, homothorax and extradenticle, is essential for EXD nuclear localization and function. Direct interaction of two homeoproteins, homothorax and extradenticle, is essential for EXD nuclear localization and function. Mech. Dev. (0925-4773) 2000 imex curation Jaw TJ., You LR., Knoepfler PS., Yao LC., Pai CY., Tang CY., Chang LP., Berthelsen J., Blasi F., Kamps MP., Sun YH. mbyhsun@ccvax.sinica.edu.tw davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Jaw TJ., You LR., Knoepfler PS., Yao LC., Pai CY., Tang CY., Chang LP., Berthelsen J., Blasi F., Kamps MP., Sun YH. mbyhsun@ccvax.sinica.edu.tw Accepted 2007-OCT-18 by DAVET. Mech. Dev. (0925-4773) 2000 davet Only protein-protein interactions imex curation Direct interaction of two homeoproteins, homothorax and extradenticle, is essential for EXD nuclear localization and function. Direct interaction of two homeoproteins, homothorax and extradenticle, is essential for EXD nuclear localization and function. Mech. Dev. (0925-4773) 2000 imex curation Jaw TJ., You LR., Knoepfler PS., Yao LC., Pai CY., Tang CY., Chang LP., Berthelsen J., Blasi F., Kamps MP., Sun YH. mbyhsun@ccvax.sinica.edu.tw davet Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Jaw TJ., You LR., Knoepfler PS., Yao LC., Pai CY., Tang CY., Chang LP., Berthelsen J., Blasi F., Kamps MP., Sun YH. mbyhsun@ccvax.sinica.edu.tw Accepted 2007-OCT-18 by DAVET. Mech. Dev. (0925-4773) 2000 davet Only protein-protein interactions imex curation exd_drome Homeobox protein extradenticle exd CG8933 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEDPNRMLAHTGGMMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGSGGYDQQQPYDNSMGGYDPNLHQDLSP DIP protein P40427 original sequence version: 142 DIP protein P40427 original sequence version: 120 79E3DC8F1F6B711F hth_drome Homeobox protein homothorax hth dtl Homeobox protein dorsotonals CG17117 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAQPRYDDGLHGYGMDSGAAAAAMYDPHAGHRPPGLQGLPSHHSPHMTHAAAAAATVGMHGYHSGAGGHGTPSHVSPVGNHLMGAIPEVHKRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDTTKPPELGSANGEGRSNADSTSHTDGASTPDVRPPSSSLSYGGAMNDDARSPGAGSTPGPLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRRLYSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYTPHPGPSGYGHDAMGYMMDSQAHMMHRPPGDPGFHQGYPHYPPAEYYGQHL 7EA4D7D1EFB16F8A exd-hth-5 2 4 unspecified role unspecified role prey prey mh region required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1393491]The shifted ranges (45-342) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-1393491]31-312 region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A In the present study, we determined which part of HTH is required for interaction with EXD. GST EXD can pull down full length HTH exd-hth-6 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey mh region required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1393498]The shifted ranges (45-342) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-1393498]31-312 physical association physical association 5B in yeast two-hybrid assays, EXD can interact with full-length HTH and ΔHD but not with ΔMH