IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. Mol. Cell. Biol. (0270-7306) 1998 imex curation Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. Mol. Cell. Biol. (0270-7306) 1998 imex curation Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. Mol. Cell. Biol. (0270-7306) 1998 imex curation Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. A mouse 9.5-day-old-embryo cDNA library. Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. Mol. Cell. Biol. (0270-7306) 1998 imex curation Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. Mol. Cell. Biol. (0270-7306) 1998 imex curation Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. Mol. Cell. Biol. (0270-7306) 1998 imex curation Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation src_chick Proto-oncogene tyrosine-protein kinase Src SRC pp60c-src Proto-oncogene c-Src protein protein chick Gallus gallus (Chicken) Chicken MGSSKSKPKDPSQRRRSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKLFGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL DIP protein P00523 original sequence version: 105 ABDB036F7D63C30A fyn_human Tyrosine-protein kinase Fyn p59-Fyn Proto-oncogene c-Fyn Src-like kinase FYN Proto-oncogene Syn protein protein human Homo sapiens Human MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL DIP protein P06241 original sequence version: 195 DIP protein P06241 original sequence version: 147 DIP protein P06241 original sequence version: 164 4A1E443A4B5A0977 arf1_human ADP-ribosylation factor 1 ARF1 protein protein human Homo sapiens Human MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK DIP protein P84077 original sequence version: 122 DIP protein P84077 original sequence version: 56 DIP protein P84077 original sequence version: 89 AAC773D4A60186B6 asap1_mouse Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 PIP2-dependent ARF1 GAP ADP-ribosylation factor-directed GTPase-activating protein 1 Development and differentiation-enhancing factor 1 Asap1 Ddef1 Kiaa1249 Shag1 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein protein protein mouse Mus musculus Mouse MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDPKEVGGLYVASRANSSRRDSQSRQGGYSMHQLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCASSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTSVGNTVLHYCSMYGKPECLKLLLRSKPTVDIVNQNGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQDEMDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFASTSTDLPTSPTSEAPPLPPRNAGKGPTGPPSTLPLGTQTSSGSSTLSKKRPPPPPPGHKRTLSDPPSPLPHGPPNKGAIPWGNDVGPLSSSKTANKFEGLSQQASTSSAKTALGPRVLPKLPQKVALRKTETSHHLSLDRTNIPPETFQKSSQLTELPQKPPLGELPPKPVELAPKPQVGELPPKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQAGDVSAKVQPPSEVTQRSHTGDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD 12950D1C4F49A909 crk_human Adapter molecule crk Proto-oncogene c-Crk CRK p38 protein protein human Homo sapiens Human MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS 4CFBFB65BFC2E265 q9qwy8-2 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 SHAG1b ASAP1b Asap1 Ddef1 Kiaa1249 Shag1 ADP-ribosylation factor-directed GTPase-activating protein 1 Development and differentiation-enhancing factor 1 PIP2-dependent ARF1 GAP 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein protein protein mouse Mus musculus Mouse MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDPKEVGGLYVASRANSSRRDSQSRQGGYSMHQLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCASSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTSVGNTVLHYCSMYGKPECLKLLLRSKPTVDIVNQNGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQDEMDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFASTSTDLPTSPTSEAPPLPPRNAGKGNDVGPLSSSKTANKFEGLSQQASTSSAKTALGPRVLPKLPQKVALRKTETSHHLSLDRTNIPPETFQKSSQLTELPQKPPLGELPPKPVELAPKPQVGELPPKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQAGDVSAKVQPPSEVTQRSHTGDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD 5C1F1D950B7B252A lyn_human Tyrosine-protein kinase Lyn JTK8 Lck/Yes-related novel protein tyrosine kinase V-yes-1 Yamaguchi sarcoma viral related oncogene homolog p53Lyn p56Lyn LYN protein protein human Homo sapiens Human MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP DIP protein P07948 original sequence version: 141 408D3D461204E378 asap1_bovin Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 PIP2-dependent ARF1 GAP ADP-ribosylation factor-directed GTPase-activating protein 1 Development and differentiation-enhancing factor 1 ASAP1 DDEF1 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein protein protein bovin Bos taurus (Bovine) Bovine MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDQKESRRDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALTMAFRGEQSAGESSLEELTKAIIEDVQRLPGNDVCCDCGSAEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCSSSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTALHYCSMYSKPECLKLLLRSKPTVDVVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEMDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLSLPGFSTPRDKQRLSYGAFTNQIFVSTSTDSPTSPIAEAPPLPPRNATKGPPGPPSTLPLSTQTSSGSSTLSKKRSPPPPPGHKRTLSDPPSPLPHGPPNKGAVPWGNDVGPSSSSKTTNKFEGLSQQSSTGSAKTALGPRVLPKLPQKVALRKTETSHHLSLDKANVPPEIFQKSSQLTELPQKPPPGDLPPKPTELAPKPPIGDLPPKPGELPPKPQLGDLPPKPQLADLPPKPQVKDLPPKPQLGELLAKPQTGDASPKAQPPLELTPKSHPADLSPNVPKQASEDTNDLTPTLPETPVPLPRKINTGKSKVRRVKTIYDCQADNDDELTFMEGEVIVVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD C1576C2EAC0ACDA8 q9qwy8-1 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 SHAG1a ASAP1a Kiaa1249 Shag1 ADP-ribosylation factor-directed GTPase-activating protein 1 Development and differentiation-enhancing factor 1 PIP2-dependent ARF1 GAP Asap1 Ddef1 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein protein protein mouse Mus musculus Mouse MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDPKEVGGLYVASRANSSRRDSQSRQGGYSMHQLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCASSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTSVGNTVLHYCSMYGKPECLKLLLRSKPTVDIVNQNGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQDEMDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFASTSTDLPTSPTSEAPPLPPRNAGKGPTGPPSTLPLGTQTSSGSSTLSKKRPPPPPPGHKRTLSDPPSPLPHGPPNKGAIPWGNDVGPLSSSKTANKFEGLSQQASTSSAKTALGPRVLPKLPQKVALRKTETSHHLSLDRTNIPPETFQKSSQLTELPQKPPLGELPPKPVELAPKPQVGELPPKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQAGDVSAKVQPPSEVTQRSHTGDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD 12950D1C4F49A909 asap1-arf1-1 5 9 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) 10 enzyme enzyme unspecified role unspecified role pza domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction asap1-arf1-2 5 9 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) 12 enzyme enzyme unspecified role unspecified role human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Increased activity of Arf1 GAp activity in lysates of cells overexpressing ASAP1b. physical interaction asap1-arf1-3 5 9 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) 14 enzyme enzyme unspecified role unspecified role bovin-brain Bos taurus brain brain Brain [cerebrum] enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction direct interaction Bovin endogenous ASAP1 is purified to homogeneity from bovin brain asap1-src-1 3 7 unspecified role unspecified role bait bait c-term sh3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role prey prey sid sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association asap1-src-2 4 15 unspecified role unspecified role prey prey sid sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait c-term sh3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association asap1-fyn-1 4 8 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey sid sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association asap1-lyn-1 4 15 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sid sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 13 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association asap1-crk-1 4 12 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sid sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association asap1-src-3 4 12 unspecified role unspecified role prey prey Q9QWY8-2:p.[Arg811Ala;Pro849Ala;Pro853Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 17:18:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg811ala,pro849ala,pro853ala' Tue Jun 30 18:28:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg811Ala;Pro849Ala;Pro853Ala]' region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait c-term sh3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Mutation analysis in two canonical SH3 binding site (P1: arg811Ala and P2: Pro910Ala-Pro913Ala) in ASAP1b show their importance for the interaction with src. asap1-fyn-2 4 12 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association asap1-lyn-2 4 12 unspecified role unspecified role prey prey region 33p radiolabel 33p radiolabel P33 33P undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association asap1-crk-2 4 15 unspecified role unspecified role prey prey Q9QWY8-1:p.[Pro910Ala;Pro913Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Fri Jul 22 11:08:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro913ala,pro910ala' Wed May 02 15:53:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro910ala,pro913ala' Tue Jun 30 18:38:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro910Ala;Pro913Ala]' Q9QWY8-1:p.[Arg811Ala;Pro910Ala;Pro913Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 18:55:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg811ala,pro910ala,pro913ala' Tue Jun 30 16:20:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg811Ala;Pro910Ala;Pro913Ala]' Q9QWY8-1:p.Arg811Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R A Wed May 02 20:23:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg811ala' Tue Jun 30 16:59:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg811Ala' region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Mutation analysis in two canonical SH3 binding site (P1: arg811Ala and P2: Pro910Ala-Pro913Ala) in ASAP1b show their importance for the interaction with Crk. asap1-src-4 2 7 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey Q9QWY8-1:p.Arg811Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:35:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg811ala' Tue Jun 30 17:26:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg811Ala' Q9QWY8-1:p.[Pro910Ala;Pro913Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 17:46:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro910ala,pro913ala' Tue Jun 30 19:26:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro910Ala;Pro913Ala]' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Q9QWY8-2 over-expressed P00523 over-expressed Mutation analysis in two canonical SH3 binding site (P1: arg811Ala and P2: Pro910Ala-Pro913Ala) in ASAP1b show their importance for the interaction with src. asap1-src-5 6 14 enzyme target enzyme target substrate substrate unspecified role unspecified role bovin-brain Bos taurus brain brain Brain [cerebrum] 7 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Endogenous bovin ASAP1 was purified to homogeneity from bovin brain. asap1-src-6 1 12 enzyme target enzyme target substrate substrate unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 enzyme enzyme unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation P00523 over-expressed Q9QWY8-2 over-expressed