DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Efficiency of signalling through cytokine receptors depends critically on receptor orientation. Efficiency of signalling through cytokine receptors depends critically on receptor orientation. Nature (0028-0836) 1998 imex curation Syed RS., Reid SW., Li C., Cheetham JC., Aoki KH., Liu B., Zhan H., Osslund TD., Chirino AJ., Zhang J., Finer-Moore J., Elliott S., Sitney K., Katz BA., Matthews DJ., Wendoloski JJ., Egrie J., Stroud RM. rsyed@amgen.com Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Syed RS., Reid SW., Li C., Cheetham JC., Aoki KH., Liu B., Zhan H., Osslund TD., Chirino AJ., Zhang J., Finer-Moore J., Elliott S., Sitney K., Katz BA., Matthews DJ., Wendoloski JJ., Egrie J., Stroud RM. rsyed@amgen.com Nature (0028-0836) 1998 IMEx epor_human Erythropoietin receptor EPOR protein protein human Homo sapiens Human MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS DIP protein P19235 original sequence version: 168 DIP protein P19235 original sequence version: 186 F9F326E162E9512A epo_human Erythropoietin EPO protein protein human Homo sapiens Human MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR C91F0E4C26A52033 epo-epor-1 1 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 6 8 direct interaction direct interaction trimeric, multimeric working 72.00%, free 66.400% 2.8A epo-epor-2 1 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 11 13 direct interaction direct interaction trimeric, multimeric working 75.800%, free 68.200% 1.9A