UniProt UniProt http://www.uniprot.org A novel 66-kilodalton protein complexes with Rrn6, Rrn7, and TATA-binding protein to promote polymerase I transcription initiation in Saccharomyces cerevisiae. A novel 66-kilodalton protein complexes with Rrn6, Rrn7, and TATA-binding protein to promote polymerase I transcription initiation in Saccharomyces cerevisiae. Mol. Cell. Biol. (0270-7306) 1996 imex curation Lin CW., Moorefield B., Payne J., Aprikian P., Mitomo K., Reeder RH. Recombinant SPT15, RRN11 and RRN7 and histidine-tagged version of RRN6 have been used in chelated nickel chromatography. rreder@fhrc.org 25-OCT-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lin CW., Moorefield B., Payne J., Aprikian P., Mitomo K., Reeder RH. Recombinant SPT15, RRN11 and RRN7 and histidine-tagged version of RRN6 have been used in chelated nickel chromatography. rreder@fhrc.org Accepted 2006-SEP-26 by JYOTI. 25-OCT-2006: Contacted by JYOTI. Returned mail. Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation A novel 66-kilodalton protein complexes with Rrn6, Rrn7, and TATA-binding protein to promote polymerase I transcription initiation in Saccharomyces cerevisiae. A novel 66-kilodalton protein complexes with Rrn6, Rrn7, and TATA-binding protein to promote polymerase I transcription initiation in Saccharomyces cerevisiae. Mol. Cell. Biol. (0270-7306) 1996 imex curation Lin CW., Moorefield B., Payne J., Aprikian P., Mitomo K., Reeder RH. Recombinant SPT15, RRN11 and RRN7 and histidine-tagged version of RRN6 have been used in chelated nickel chromatography. rreder@fhrc.org 25-OCT-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lin CW., Moorefield B., Payne J., Aprikian P., Mitomo K., Reeder RH. results with RRN6 as bait have not been taken as it causes activation by its own. Recombinant SPT15, RRN11 and RRN7 and histidine-tagged version of RRN6 have been used in chelated nickel chromatography. rreder@fhrc.org Accepted 2006-SEP-26 by JYOTI. 25-OCT-2006: Contacted by JYOTI. Returned mail. Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation A novel 66-kilodalton protein complexes with Rrn6, Rrn7, and TATA-binding protein to promote polymerase I transcription initiation in Saccharomyces cerevisiae. A novel 66-kilodalton protein complexes with Rrn6, Rrn7, and TATA-binding protein to promote polymerase I transcription initiation in Saccharomyces cerevisiae. Mol. Cell. Biol. (0270-7306) 1996 imex curation Lin CW., Moorefield B., Payne J., Aprikian P., Mitomo K., Reeder RH. Recombinant SPT15, RRN11 and RRN7 and histidine-tagged version of RRN6 have been used in chelated nickel chromatography. rreder@fhrc.org 25-OCT-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lin CW., Moorefield B., Payne J., Aprikian P., Mitomo K., Reeder RH. Recombinant SPT15, RRN11 and RRN7 and histidine-tagged version of RRN6 have been used in chelated nickel chromatography. rreder@fhrc.org Accepted 2006-SEP-26 by JYOTI. 25-OCT-2006: Contacted by JYOTI. Returned mail. Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation rrn7_yeast RNA polymerase I-specific transcription initiation factor RRN7 RRN7 J1273 YJL025W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTFIRGPICGTDNCPSRLWRIIDGRRTCQYGHVMEGDVEFNDDEDDLNGLGAGVITRRLNLTTNATGSFQSSQLTNSQLLQQQQRQSHKKFKKLIGHEAKLLFLKSFQFILKRQIRWLITEMRFPKEFEHVAKIIWLKILKTINDQPQEELKLQLHMTSTISILYLASTHLSLPVYTCDYIKWICTAKMPYFQASEILPKSWRIQLPNYYVSILEGSISPFNGQLYNKIALTCGMIHFKEFFNSEISCQGLLLKLVMQCALPPEFYFYTKQVIEFEETDIRNLTLWERTDERHTGRVSNHAELRVLSYFMLTINWMLSFDRDRQYPLKWILSLTESLTQRTTTSESIGRNIVKVVYPDKPTSSDYFQWSEEETLEFLKWMEKQFLPTQTKSLHNENGSMEMTIDQKIARRKLYKIFPLDREANHDGEFNDSTHQLTFIEDLQERYAKQTPFFESNKIRDSLNYQEANPPARKEAIGRLLTHIASQLLVDFAISKEQLKDCISRIKNACLHRMN 30459F9BC27197D6 rrn6_yeast RNA polymerase I-specific transcription initiation factor RRN6 RRN6 YBL0311 YBL0312 YBL014C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEGQIPSSDVLGSQLGVGVQGASLYCPQENYTTKKQEKPQWLRPVDDTLAEDALDLHIVVKSLLCDTAIRYISDDKVLQESDADDDLITSDIDEDTDNQGDTSIVVNPVIPVVPKDVHFFKKVDVGNDSMFGVNCDTPVSFQDYIPSDLLRNLDDTLQESTNSSRPMQDAFFWDPTVANRLDSQYIQTASDLRNYRDGTEIIAYASGKTGSVLNIAVLTRQNTLHLNRHNNVTSIELHSPIKSIKIPGASESIGRRSNLVGIITENSFQIFRIESVHSRSCDVMVSSSEPLYFVEIDDLQVVDFAFNPWDLQQFAIIDIKGNWSIGRIPKNFNNNNKRKLQLIDNLHGTIFDPEELSSWKRIEWFSHFQKILVFDRSKMIEIDFMNNWQTEVVQAKAWSNIRDYKRIDDKNGILLTSREIIIVGASESNDPVRRISWKHDLDPDDTTLRITVQKVKKPDHILLVAFVYSMRHKRIYMHVFSHRKANLFQSLGCSTVLEIPGGTPTGIETILTLDHIDDESRREEDADENFELVVDFLVKLRNSSEVYYYALSNTQNSEPNKQETPIIVDHPEWASLFNNADEREKESIGALVSQIKLKERERISRVQNLIEHENSHDEDKYLQDLGYRLSIATNELLESWQKTKDESILSGSLSHSKLKNLLENSDSFASIPEFSSLLDQFFQYYQDQDVTFIGFEKLLHLFLHEDVPGLDIFYNKLLQCWVLVSPQAELLTKEIVKDIIWSLARLEKPSLFEPIQNEISRSLSGPYQDIISSWDMDDINEEDESNEFNFDSQFSAPFNGRPPFNLNSQSQIPTIKSSQSSGLARRKRILKTQSQKATPLSQSTQNLSVLPDSMTPAFTLMQPPSSQISFVNDSQPRNSQKAKKKKKRIRGFG BF42EFD2AED77F15 rrn11_yeast RNA polymerase I-specific transcription initiation factor RRN11 YM9827.09C YML043C RRN11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKEDSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDNSSVENSFGDVYETNAEFLDTQLMDLSPEDNGLDEMHYSDEDSSE 726B0963F0E79783 tbp_yeast TATA-box-binding protein YER148W SPT15 BTF1 TBP1 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription factor D Transcription initiation factor TFIID TBP subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM 50365FFF1D3718CE 50365FFF1D3718CE rrn6-spt15-1 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3B rrn11-spt15-2 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3A rrn7-rrn6-1 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Table 2 rrn11-rrn6-2 2 5 unspecified role unspecified role prey prey P32786:p.[Leu50Ala;Leu57Ala;Leu64Ala] leu50ala-leu57ala-leu64ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Fri Jul 22 11:10:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu50ala,leu64ala,leu57ala' Wed May 02 19:57:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu50ala,leu57ala,leu64ala' Tue Jun 30 16:38:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu50Ala;Leu57Ala;Leu64Ala]' 6 unspecified role unspecified role bait bait Q04712:p.[Leu481Ala;Leu488Ala;Leu495Ala] leu481ala-leu488ala-leu495ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Fri Jul 22 11:07:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu495ala,leu488ala,leu481ala' Wed May 02 14:38:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu481ala,leu488ala,leu495ala' Tue Jun 30 16:12:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu481Ala;Leu488Ala;Leu495Ala]' physical association physical association Table 2