IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. Mol. Cell. Biol. (0270-7306) 1996 imex curation Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Accepted 2006-MAR-16 by JYOTI. Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. Mol. Cell. Biol. (0270-7306) 1996 imex curation Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Accepted 2006-MAR-16 by JYOTI. Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. Mol. Cell. Biol. (0270-7306) 1996 imex curation Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Accepted 2006-MAR-16 by JYOTI. Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. Mol. Cell. Biol. (0270-7306) 1996 imex curation Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Accepted 2006-MAR-16 by JYOTI. Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation kss1_yeast Mitogen-activated protein kinase KSS1 KSS1 Kinase suppressor of SST2 YGR040W protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSDEPEYPPLNLDDEFWKLDNKIMRPEEEEEVPIEMLKDMLYDELMKTME 5FA42161B5FD51B5 5FA42161B5FD51B5 fus3_yeast Mitogen-activated protein kinase FUS3 FUS3 DAC2 YBL016W YBL0303 YBL03.21 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPKRIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEGEPIPPSFFEFDHYKEALTTKDLKKLIWNEIFS 5117980D20A1E7E2 5117980D20A1E7E2 ste7_yeast Serine/threonine-protein kinase STE7 STE7 D1525 YDL159W protein protein yeast Saccharomyces cerevisiae Baker's yeast MFQRKTLQRRNLKGLNLNLHPDVGNNGQLQEKTETHQGQSRIEGHVMSNINAIQNNSNLFLRRGIKKKLTLDAFGDDQAISKPNTVVIQQPQNEPVLVLSSLSQSPCVSSSSSLSTPCIIDAYSNNFGLSPSSTNSTPSTIQGLSNIATPVENEHSISLPPLEESLSPAAADLKDTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTIPVEQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLHHDLIMKYVSPSKDDKFRHWCRKIKSKIKEDKRIKREALDRAKLEKKQSERSTH C8A75899CFBE8BDE C8A75899CFBE8BDE ste7-kss1-1 3 7 unspecified role unspecified role bait bait in vitro In vitro 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association ste7-fus3-1 3 6 unspecified role unspecified role prey prey in vitro In vitro 7 unspecified role unspecified role bait bait in vitro In vitro physical association physical association ste7-fus3-2 2 6 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association ste7-fus3-3 4 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro physical association physical association P06784 electroporation ste7-kss-1 4 7 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 5 unspecified role unspecified role prey prey physical association physical association P06784 electroporation ste7-kss1-2 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role 7 enzyme enzyme unspecified role unspecified role n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range phosphorylation phosphorylation reaction phosphorylation Phosphorylation of P14681 on Thr-183 and Tyr-185