UniProt UniProt http://www.uniprot.org The PCL2 (ORFD)-PHO85 cyclin-dependent kinase complex: a cell cycle regulator in yeast. The PCL2 (ORFD)-PHO85 cyclin-dependent kinase complex: a cell cycle regulator in yeast. Science (0036-8075) 1994 imex curation Measday V., Moore L., Ogas J., Tyers M., Andrews B. brenda.andrews@utoronto.ca 01-DEC-2006: Contacted by JYOTI. Yeast cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Measday V., Moore L., Ogas J., Tyers M., Andrews B. brenda.andrews@utoronto.ca Accepted 2006-NOV-20 by DAVET. Yeast cDNA library 01-DEC-2006: Contacted by JYOTI. Yeast cDNA library Science (0036-8075) 1994 Only protein-protein interactions imex curation The PCL2 (ORFD)-PHO85 cyclin-dependent kinase complex: a cell cycle regulator in yeast. The PCL2 (ORFD)-PHO85 cyclin-dependent kinase complex: a cell cycle regulator in yeast. Science (0036-8075) 1994 imex curation Measday V., Moore L., Ogas J., Tyers M., Andrews B. brenda.andrews@utoronto.ca 01-DEC-2006: Contacted by JYOTI. Yeast cDNA library Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Measday V., Moore L., Ogas J., Tyers M., Andrews B. brenda.andrews@utoronto.ca Accepted 2006-NOV-20 by DAVET. Yeast cDNA library 01-DEC-2006: Contacted by JYOTI. Yeast cDNA library Science (0036-8075) 1994 Only protein-protein interactions imex curation The PCL2 (ORFD)-PHO85 cyclin-dependent kinase complex: a cell cycle regulator in yeast. The PCL2 (ORFD)-PHO85 cyclin-dependent kinase complex: a cell cycle regulator in yeast. Science (0036-8075) 1994 imex curation Measday V., Moore L., Ogas J., Tyers M., Andrews B. brenda.andrews@utoronto.ca 01-DEC-2006: Contacted by JYOTI. Yeast cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Measday V., Moore L., Ogas J., Tyers M., Andrews B. brenda.andrews@utoronto.ca Accepted 2006-NOV-20 by DAVET. Yeast cDNA library 01-DEC-2006: Contacted by JYOTI. Yeast cDNA library Science (0036-8075) 1994 Only protein-protein interactions imex curation pcl1_yeast PHO85 cyclin-1 PCL1 HCS26 YNL289W N0536 G1/S-specific cyclin PCL1 Cyclin HCS26 protein protein yeast Saccharomyces cerevisiae Baker's yeast MCEYSKALHILLKSPVTDDIIKFLTDTTLRVVPSSNYPTPPGSPGEKHLTRLPSLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDLRVNTEDLILDLQPLLEPIKQDLARSSDQRKRINMMMSMNRRTCAGTSPIRSNNRFKLYEKQRNVSIASDLSSATLVDSCNDLRRLKDVTNIANNTVANTNYVRTVEKWNDNVNRQSWDLEQIMSQHGF DC9E05C3C2EBD0F6 pho85_yeast Cyclin-dependent protein kinase PHO85 PHO85 SSG3 P7102.18A Serine/threonine-protein kinase PHO85 Negative regulator of the PHO system YPL031C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYYHHAS 246A4358870B00EC 246A4358870B00EC pcl2_yeast PHO85 cyclin-2 PCL2 CLN4 YDL127W D2223 G1/S-specific cyclin PCL2 Cyclin HCS26 homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNYEALLKFNRKAVSKEMVQYLASTTASIIKIKKTNSMIDIALPAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITCLSPFLKPIKEEQLYKSQRDCRTLKNFSAQEKDIVNKTSISHSRSSSNMSIPSLASTSTLSTLESRRSNLSNYSNRIRTLPELHESNNISDKFSPRTYNIDSKHDNKENRPIPTIKPFNFSKARPVILKTGLNKQIIKEDTKVKKSNWSNYFKS 914BE1E2B92858CA pho85-pcl2-3 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association No figure pho85-pcl2-4 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association No figure pho85-hcs26 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association No figure pho85-pcl2-5 2 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro physical association physical association Fig. 1 pho85-pcl2-6 2 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 1