MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Ferredoxin/ferredoxin-thioredoxin reductase complex: Complete NMR mapping of the interaction site on ferredoxin by gallium substitution. Ferredoxin/ferredoxin-thioredoxin reductase complex: Complete NMR mapping of the interaction site on ferredoxin by gallium substitution. FEBS Lett. (0014-5793) 2006 imex curation Xu X., Kim SK., Schürmann P., Hirasawa M., Tripathy JN., Smith J., Knaff DB., Ubbink M. 2009-01-08 Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Xu X., Kim SK., Schürmann P., Hirasawa M., Tripathy JN., Smith J., Knaff DB., Ubbink M. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation ftrv_syny3 Ferredoxin-thioredoxin reductase, variable chain ftrV Ferredoxin-thioredoxin reductase subunit A ssr0330 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLIED DIP protein Q55781 original sequence version: 81 37C5E0D41C22C18E fer_syny3 Ferredoxin-1 Ferredoxin I petF fed ssl0020 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY DIP protein P27320 original sequence version: 110 137FFD4F87A66DA1 ftrv-petf 1 FTR 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Ferrodoxin 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction F3 F2 FEBS-Letters mint petf-ftrv 1 Ferrodoxin 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified FTR 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction F3 F2 FEBS-Letters mint