IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of the DsbB-DsbA complex reveals a mechanism of disulfide bond generation. Crystal structure of the DsbB-DsbA complex reveals a mechanism of disulfide bond generation. Cell (0092-8674) 2006 imex curation Inaba K., Murakami S., Suzuki M., Nakagawa A., Yamashita E., Okada K., Ito K. kito@virus.kyoto-u.ac.jp 08-DEC-2006: Contacted by JYOTI. Only protein-protein interactions 1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Inaba K., Murakami S., Suzuki M., Nakagawa A., Yamashita E., Okada K., Ito K. kito@virus.kyoto-u.ac.jp Accepted 2006-DEC-4 by JYOTI. 08-DEC-2006: Contacted by JYOTI. Cell (0092-8674) 2006 Only protein-protein interactions 1 imex curation dsbb_ecoli Disulfide bond formation protein B dsbB roxB b1185 JW5182 ycgA Disulfide oxidoreductase protein protein ecoli Escherichia coli (strain K12) MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGR 9CBD673D51E9F09B dsba_ecoli Thiol:disulfide interchange protein DsbA dsbA dsf ppfA b3860 JW3832 protein protein ecoli Escherichia coli (strain K12) MKKIWLALAGLVLAFSASAAQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK DIP protein P0AEG4 original sequence version: 53 DIP protein P0AEG4 original sequence version: 48 10527E876FCAEE55 dsbb-dsba-1 1 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P0AEG4:p.Cys52Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 18:26:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys52ala' Tue Jun 30 19:55:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys52Ala' ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component P0A6M2:p.Cys130Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:57:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys130ser' Tue Jun 30 20:02:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys130Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction 3.7 A we determined the crystal structure of the DsbB-DsbA complex at 3.7 � resolution. The structure of DsbB revealed four transmembrane helices and one short horizontal helix juxtaposed with Cys130 in the mobile periplasmic loop. DsbB in the resting state contains a Cys104-Cys130 disulfide, Cys104 in the binary complex is engaged in the intermolecular disulfide bond and captured by the hydrophobic groove of DsbA, resulting in separation from Cys130. Rwork 0.334, Rfree 0.357