IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. Cell (0092-8674) 2006 imex curation Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr 08-DEC-2006: Contacted by JYOTI. Only protein-protein interactions 18 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr Accepted 2006-NOV-27 by JYOTI. 08-DEC-2006: Contacted by JYOTI. Cell (0092-8674) 2006 Only protein-protein interactions 18 imex curation Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. Cell (0092-8674) 2006 imex curation Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr 08-DEC-2006: Contacted by JYOTI. Only protein-protein interactions 18 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag immunost anti tag immunostaining anti tag immunost Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr Accepted 2006-NOV-27 by JYOTI. 08-DEC-2006: Contacted by JYOTI. Cell (0092-8674) 2006 Only protein-protein interactions 18 imex curation Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. Cell (0092-8674) 2006 imex curation Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr 08-DEC-2006: Contacted by JYOTI. Only protein-protein interactions 18 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr Accepted 2006-NOV-27 by JYOTI. 08-DEC-2006: Contacted by JYOTI. Cell (0092-8674) 2006 Only protein-protein interactions 18 imex curation Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. Cell (0092-8674) 2006 imex curation Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr 08-DEC-2006: Contacted by JYOTI. Only protein-protein interactions 18 human-t1 Homo sapiens lymphoid cell line T1 t1 human lymphoid cell line T1 http://www.lgcpromochem.com/atcc/ anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr Accepted 2006-NOV-27 by JYOTI. 08-DEC-2006: Contacted by JYOTI. Cell (0092-8674) 2006 Only protein-protein interactions 18 imex curation Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. Cell (0092-8674) 2006 imex curation Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr 08-DEC-2006: Contacted by JYOTI. Only protein-protein interactions 18 human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr Accepted 2006-NOV-27 by JYOTI. 08-DEC-2006: Contacted by JYOTI. Cell (0092-8674) 2006 Only protein-protein interactions 18 imex curation pdia1_human Protein disulfide-isomerase P4HB PDI PDIA1 PO4DB Prolyl 4-hydroxylase subunit beta Cellular thyroid hormone-binding protein p55 ERBA2L protein protein human Homo sapiens Human MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL DIP protein P07237 original sequence version: 198 906CE6D9900B8FCE tpsn_human Tapasin TAP-binding protein TAP-associated protein NGS-17 TAPBP NGS17 TAPA protein protein human Homo sapiens Human MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE 7340549519B288AD b2mg_human Beta-2-microglobulin B2M CDABP0092 HDCMA22P protein protein human Homo sapiens Human MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM DIP protein P61769 original sequence version: null DIP protein P61769 original sequence version: 138 DIP protein P61769 original sequence version: 134 DIP protein P61769 original sequence version: 135 DIP protein P61769 original sequence version: 116 DIP protein P61769 original sequence version: 60 DIP protein P61769 original sequence version: 79 DIP protein P61769 original sequence version: 87 DIP protein P61769 original sequence version: 93 DIP protein P61769 original sequence version: 94 DIP protein P61769 original sequence version: 91 DIP protein P61769 original sequence version: 106 DIP protein P61769 original sequence version: 111 AFD2DBEF07DCEF27 idmekihk_peptide IDMEKIHK low-affinity peptide for HLA-A2.1 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) IDMEKIHK An amino acid sequence which is not represented in UniProt 4E31E0533B169AA0 tap1_human Antigen peptide transporter 1 ABCB2 PSF1 RING4 Y3 TAP1 Peptide transporter TAP1 ATP-binding cassette sub-family B member 2 Peptide supply factor 1 Peptide transporter PSF1 Peptide transporter involved in antigen processing 1 Really interesting new gene 4 protein protein protein human Homo sapiens Human MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATVGSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAFVVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE DIP protein Q03518 original sequence version: 123 DIP protein Q03518 original sequence version: 173 9CA5FF96FADD6A1B pdia3_human Protein disulfide-isomerase A3 Disulfide isomerase ER-60 Endoplasmic reticulum resident protein 60 58 kDa microsomal protein Endoplasmic reticulum resident protein 57 58 kDa glucose-regulated protein PDIA3 ERP60 GRP58 ERP57 protein protein human Homo sapiens Human MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL DIP protein P30101 original sequence version: 82 529E5B6692D0D7E9 tap2_human Antigen peptide transporter 2 ATP-binding cassette sub-family B member 3 Peptide transporter TAP2 Peptide supply factor 2 Peptide transporter PSF2 Peptide transporter involved in antigen processing 2 TAP2 ABCB3 PSF2 RING11 Y1 Really interesting new gene 11 protein protein protein human Homo sapiens Human MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL DIP protein Q03519 original sequence version: 123 DIP protein Q03519 original sequence version: 176 E7E4A7F6A2A3B48B ilmekihkv_peptide ILMEKIHKV high-affinity peptide for HLA-A2.1 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ILMEKIHKV An amino acid sequence which is not represented in UniProt 44EE31E0533B1697 calr_human Calreticulin CRP55 Calregulin HACBP Endoplasmic reticulum resident protein 60 grp60 CALR CRTC protein protein human Homo sapiens Human MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL BC37C3C0F1054FB2 tap1-b2m 1 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association 1 A we purified TAP complexes from digitonin lysates of HeLa cells. Both silver staining and subsequent analysis by tandem mass spectrometry (MS/MS) revealed that several proteins, including calreticulin, tapasin, MHC class I heavy chain, b2m, and Ig g H chain, specifically associated with TAP (Figure 1A). By MS/MS analysis of the 58 kDa protein band, we found that this band was a mixture of ERp57 and PDI. Some of the proteins precipiated with TAP1 could not be added as interactors (MHC class I heavy chain, Ig gamma H-chain, light chain). tap1-tap2 3 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 1 B We confirmed the identity of the TAP-associated components by reprecipitating anti-TAP1 immunoprecipitates from digitonin lysates of radiolabeled HeLa cells with the indicated antibodies (Figure 1B). TAP1, TAP2, tapasin, class I heavy chain, calreticulin, ERp57, and PDI, but not calnexin, were positively identified by reprecipitation (Figure 1B). tap1-tapbp 3 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 1 B, S1 We confirmed the identity of the TAP-associated components by reprecipitating anti-TAP1 immunoprecipitates from digitonin lysates of radiolabeled HeLa cells with the indicated antibodies (Figure 1B). TAP1, TAP2, tapasin, class I heavy chain, calreticulin, ERp57, and PDI, but not calnexin, were positively identified by reprecipitation (Figure 1B). tap1-calr 3 10 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association 1 B We confirmed the identity of the TAP-associated components by reprecipitating anti-TAP1 immunoprecipitates from digitonin lysates of radiolabeled HeLa cells with the indicated antibodies (Figure 1B). TAP1, TAP2, tapasin, class I heavy chain, calreticulin, ERp57, and PDI, but not calnexin, were positively identified by reprecipitation (Figure 1B). tap1-pd1a3 3 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 1 B, S1 We confirmed the identity of the TAP-associated components by reprecipitating anti-TAP1 immunoprecipitates from digitonin lysates of radiolabeled HeLa cells with the indicated antibodies (Figure 1B). TAP1, TAP2, tapasin, class I heavy chain, calreticulin, ERp57, and PDI, but not calnexin, were positively identified by reprecipitation (Figure 1B). tap1-p4hb 3 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 1 B, S1 We confirmed the identity of the TAP-associated components by reprecipitating anti-TAP1 immunoprecipitates from digitonin lysates of radiolabeled HeLa cells with the indicated antibodies (Figure 1B). TAP1, TAP2, tapasin, class I heavy chain, calreticulin, ERp57, and PDI, but not calnexin, were positively identified by reprecipitation (Figure 1B). tap1-pd1a3-1 4 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association S1 These results demonstrate that PDI is a component of the peptide-loading complex irrespective of cell type. tap1-p4hb-1 4 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association S1 These results demonstrate that PDI is a component of the peptide-loading complex irrespective of cell type. tap1-tapbp-1 4 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association S1 These results demonstrate that PDI is a component of the peptide-loading complex irrespective of cell type. tap1-pd1a3-2 5 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association S1 These results demonstrate that PDI is a component of the peptide-loading complex irrespective of cell type. tap1-p4hb-2 5 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association S1 These results demonstrate that PDI is a component of the peptide-loading complex irrespective of cell type. tap1-tapbp-3 5 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association S1 These results demonstrate that PDI is a component of the peptide-loading complex irrespective of cell type. tap1-ilmekihkv 2 10 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 13 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association S2 A Photocrosslinking analysis revealed that both ILMEKIHKV and IDMEKIHK peptides (high- and low-affinity peptides for A2.1, respectively) (Rammensee et al., 1999) can bind TAP, PDI, and PDI-abb0, but not PDI-ab tap1-idmekihk 2 9 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association S2 A Photocrosslinking analysis revealed that both ILMEKIHKV and IDMEKIHK peptides (high- and low-affinity peptides for A2.1, respectively) (Rammensee et al., 1999) can bind TAP, PDI, and PDI-abb0, but not PDI-ab tap2-ilmekihkv 2 12 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 13 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association S2 A Photocrosslinking analysis revealed that both ILMEKIHKV and IDMEKIHK peptides (high- and low-affinity peptides for A2.1, respectively) (Rammensee et al., 1999) can bind TAP, PDI, and PDI-abb0, but not PDI-ab tap2-idmekihk 2 9 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association S2 A Photocrosslinking analysis revealed that both ILMEKIHKV and IDMEKIHK peptides (high- and low-affinity peptides for A2.1, respectively) (Rammensee et al., 1999) can bind TAP, PDI, and PDI-abb0, but not PDI-ab p4hb-ilmekihkv 2 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind range range range range human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 13 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association S2 B Photocrosslinking analysis revealed that both ILMEKIHKV and IDMEKIHK peptides (high- and low-affinity peptides for A2.1, respectively) (Rammensee et al., 1999) can bind TAP, PDI, and PDI-abb0, but not PDI-ab This result suggests that the b' domain of PDI binds the peptide. The range of the required to bind sequence in PDI was taken from the reference Edman et al. (1998) given by the authors, which describes rat PDI. Rat and human PDI are approximately 93% identical and 96% similar. p4hb-idmekihk 2 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind range range range range human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 9 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association S2 B Photocrosslinking analysis revealed that both ILMEKIHKV and IDMEKIHK peptides (high- and low-affinity peptides for A2.1, respectively) (Rammensee et al., 1999) can bind TAP, PDI, and PDI-abb0, but not PDI-ab This result suggests that the b' domain of PDI binds the peptide. The range of the required to bind sequence in PDI was taken from the reference Edman et al. (1998) given by the authors, which describes rat PDI. Rat and human PDI are approximately 93% identical and 96% similar.