MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8. Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8. EMBO J. (0261-4189) 2006 imex curation Hargous Y., Hautbergue GM., Tintaru AM., Skrisovska L., Golovanov AP., Stevenin J., Lian LY., Wilson SA., Allain FH. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hargous Y., Hautbergue GM., Tintaru AM., Skrisovska L., Golovanov AP., Stevenin J., Lian LY., Wilson SA., Allain FH. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation nxf1_human Nuclear RNA export factor 1 NXF1 TAP Tip-associating protein Tip-associated protein mRNA export factor TAP protein protein human Homo sapiens Human MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVAMSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK DIP protein Q9UBU9 original sequence version: 157 DIP protein Q9UBU9 original sequence version: 146 338872AADA789FBF srsf3_human Serine/arginine-rich splicing factor 3 Pre-mRNA-splicing factor SRP20 SRSF3 SRP20 SFRS3 Splicing factor, arginine/serine-rich 3 protein protein human Homo sapiens Human MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK DIP protein P84103 original sequence version: 125 02F0A5EE33FF28A0 srsf7_human Serine/arginine-rich splicing factor 7 SRSF7 Splicing factor 9G8 SFRS7 Splicing factor, arginine/serine-rich 7 protein protein human Homo sapiens Human MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD DIP protein Q16629 original sequence version: 145 49136754D9630853 nxf1-srsf3 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated P84103:p.Arg86Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Tue Jul 12 10:51:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:17:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg86glu' Tue Jun 30 17:42:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg86Glu' range MINT-3379967: original sequence: 86-86 : VRVELSNGEKRSRNRGPPPS binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3379976: original sequence: 1-90 : MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRN Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4B EMBO-Journal homomint mint srsf3-nxf1 1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3379990: original sequence: 84-90 : CRVRVELSNGEKRSRNRGPPPSWGRR gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F4C EMBO-Journal homomint mint srsf7-nxf1 1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3380633: original sequence: 81-98 : LSTGMPRRSRFDRPPAR Stoichiometry: 1.0 direct interaction direct interaction F4F EMBO-Journal homomint mint nxf1-srsf7 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3380061: original sequence: 12-98 : KVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPAR Q16629:p.Arg87Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Tue Jul 12 10:57:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:29:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg87glu' Tue Jun 30 16:14:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg87Glu' range MINT-3380064: original sequence: 87-87 : VRVELSTGMPRRSRFDRPPA Q16629:p.Arg88Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Tue Jul 12 10:57:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:13:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg88glu' Tue Jun 30 19:00:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg88Glu' range MINT-3380067: original sequence: 88-88 : RVELSTGMPRRSRFDRPPAR Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4E EMBO-Journal homomint mint nxf1-srsf7-1 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q16629:p.Arg98Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Tue Jul 12 10:23:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:50:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg98glu' Tue Jun 30 17:37:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg98Glu' range MINT-3380073: original sequence: 98-98 : RSRFDRPPARRPFDPNDRCY Q16629:p.Arg97Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Tue Jul 12 10:58:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:14:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg97glu' Tue Jun 30 16:19:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg97Glu' range MINT-3380076: original sequence: 97-97 : RRSRFDRPPARRPFDPNDRC binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3380078: original sequence: 12-98 : KVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPAR Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4E EMBO-Journal homomint mint nxf1-srsf3-1 1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated P84103:p.Arg88Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Tue Jul 12 10:23:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:52:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg88glu' Tue Jun 30 16:33:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg88Glu' range MINT-3380588: original sequence: 88-88 : VELSNGEKRSRNRGPPPSWG binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3380590: original sequence: 1-90 : MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRN Stoichiometry: 1.0 physical association physical association F4B EMBO-Journal homomint mint nxf1-srsf3-2 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated P84103:p.Arg90Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Tue Jul 12 10:58:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:01:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg90glu' Tue Jun 30 16:45:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg90Glu' range MINT-3380608: original sequence: 90-90 : LSNGEKRSRNRGPPPSWGRR binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3380616: original sequence: 1-90 : MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRN Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4B EMBO-Journal homomint mint